Anti-Neurotensin antibody (ab168954)
Key features and details
- Mouse polyclonal to Neurotensin
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Neurotensin antibody
See all Neurotensin primary antibodies -
Description
Mouse polyclonal to Neurotensin -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow, Dog
-
Immunogen
Full length protein corresponding to Human Neurotensin aa 1-170.
Sequence:MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAH VPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEA MLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKR QLYENKPRRPYILKRDSYYY
Database link: NP_006174.1 -
Positive control
- Neurotensin transfected 293T cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab168954 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 20 kDa. |
Target
-
Function
Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle. -
Sequence similarities
Belongs to the neurotensin family. -
Cellular localization
Secreted. Cytoplasmic vesicle > secretory vesicle. Packaged within secretory vesicles. - Information by UniProt
-
Database links
- Entrez Gene: 280881 Cow
- Entrez Gene: 611687 Dog
- Entrez Gene: 4922 Human
- Omim: 162650 Human
- SwissProt: P01156 Cow
- SwissProt: P10673 Dog
- SwissProt: P30990 Human
- Unigene: 80962 Human
-
Alternative names
- Human proneurotensin antibody
- Large neuromedin N antibody
- Neuromedin N preproprotein antibody
see all
Images
-
Western blot - Anti-Neurotensin antibody (ab168954)All lanes : Anti-Neurotensin antibody (ab168954) at 1 µg/ml
Lane 1 : Neurotensin transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Developed using the ECL technique.
Predicted band size: 20 kDa
Datasheets and documents
References (1)
ab168954 has been referenced in 1 publication.
- Su ZJ et al. Neurotensin promotes cholangiocarcinoma metastasis via the EGFR/AKT pathway. Gene 687:143-150 (2019). PubMed: 30359740
