Overview

  • Product name

  • Description

    Rabbit polyclonal to Neurotensin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Neurotensin aa 42-167. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    HTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPT ALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIK RKIPYILKRQLYENKPRRPYILKRDS


    Database link: P30990

  • Positive control

    • WB: Recombinant human Neurotensin protein; Mouse small intestine, cerebrum and stomach lysates. IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 20 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
  • Sequence similarities

    Belongs to the neurotensin family.
  • Cellular localization

    Secreted. Cytoplasmic vesicle > secretory vesicle. Packaged within secretory vesicles.
  • Information by UniProt
  • Database links

  • Alternative names

    • Human proneurotensin antibody
    • Large neuromedin N antibody
    • Neuromedin N preproprotein antibody
    • Neurotensin/neuromedin N antibody
    • NEUT_HUMAN antibody
    • NMN 125 antibody
    • NmN antibody
    • NmN-125 antibody
    • NN antibody
    • NT antibody
    • NT/N antibody
    • NTRH antibody
    • NTS antibody
    • NTS1 antibody
    • Pro neurotensin/neuromedin antibody
    • Proneuromedin N mRNA antibody
    • Tail peptide antibody
    see all

Images

  • Anti-Neurotensin antibody (ab233107) at 2 µg + Recombunant human Neurotensin protein

    Predicted band size: 20 kDa

  • Anti-Neurotensin antibody (ab233107) at 2 µg/ml + Mouse small intestine tissue lysate

    Secondary
    HRP-Linked goat anti-Rabbit IgG at 0.2 µg/ml

    Predicted band size: 20 kDa

  • Anti-Neurotensin antibody (ab233107) at 2 µg/ml + Mouse cerebrum tissue lysate

    Secondary
    HRP-Linked goat anti-Rabbit IgG at 0.2 µg/ml

    Predicted band size: 20 kDa

  • Anti-Neurotensin antibody (ab233107) at 2 µg/ml + Mouse stomach tissue lysate

    Secondary
    HRP-Linked goat anti-Rabbit IgG at 0.2 µg/ml

    Predicted band size: 20 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Neurotensin using ab233107 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab233107 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up