Overview

  • Product name

  • Description

    Rabbit polyclonal to Neurturin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human Neurturin aa 96-197. Recombinant Human Neurturin protein produced using CHO-suspension cell line, and then purified from the cell culture supernatant
    Sequence:

    ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGL RRLRQRRRLR RERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARE CACV


    Database link: Q99748

  • Positive control

    • Human Neurturin expressed in CHOEBNALT85 cell culture supernatant.
  • General notes

    As product is (NH4)2SO4 precipitate, mix well by pipetting or vortexing prior use

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Constituents: 99% PBS, Ammonium sulphate

    Concentrated ammonium sulphate
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab205558 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 1 µg/ml. Predicted molecular weight: 22 kDa.
ICC/IF Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    Supports the survival of sympathetic neurons in culture. May regulate the development and maintenance of the CNS. Might control the size of non-neuronal cell population such as haemopoietic cells.
  • Involvement in disease

    Defects in NRTN are a cause of Hirschsprung disease (HSCR) [MIM:142623]. In association with mutations of RET gene, and possibly with other loci, defects in NRTN are involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction.
  • Sequence similarities

    Belongs to the TGF-beta family. GDNF subfamily.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Neurturin antibody
    • Neurturin precursor antibody
    • NRTN antibody
    • NRTN_HUMAN antibody
    • NTN antibody
    • prepro-neurturin antibody
    see all

Images

  • All lanes : Anti-Neurturin antibody (ab205558) at 1/5000 dilution

    Lane 1 : Human Neurturin expressed in CHOEBNALT85 cell culture supernatant
    Lane 2 : non transfected CHOEBNALT85 cell culture supernatant

    Lysates/proteins at 5 µl per lane.

    Secondary
    All lanes : Rabbit Anti-Chicken IgY H&L (HRP) (ab6753)

    Predicted band size: 22 kDa

References

ab205558 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205558.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up