Overview

  • Product name

    Anti-Nexilin/F-actin-binding protein antibody
    See all Nexilin/F-actin-binding protein primary antibodies
  • Description

    Rabbit polyclonal to Nexilin/F-actin-binding protein
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IPmore details
    Unsuitable for: WB
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Synthetic peptide corresponding to Human Nexilin/F-actin-binding protein aa 200-250.
    Sequence:

    ERIKYEEDKRIRYEEQRPSLKEAKCLSLVMDDEIESEAKKESLSPGKLKL T

  • Positive control

    • 293T whole cell lysate.
  • General notes

    Protein previously labeled as Nexilin.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab140435 was affinity purified using an epitope specific to Nexilin/F-actin-binding protein immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab140435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
  • Application notes
    Is unsuitable for WB.
  • Target

    • Function

      Involved in regulating cell migration through association with the actin cytoskeleton. Has an essential role in the maintenance of Z line and sarcomere integrity.
    • Tissue specificity

      Abundantly expressed in heart and skeletal muscle, and at lower levels in placenta, lung, liver and pancreas. Also expressed in HeLa S3 and Molt-4 cells.
    • Involvement in disease

      Defects in NEXN are the cause of cardiomyopathy dilated type 1CC (CMD1CC) [MIM:613122]. A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
      Defects in NEXN are the cause of cardiomyopathy familial hypertrophic type 20 (CMH20) [MIM:613876]. CMH20 is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
    • Sequence similarities

      Contains 1 Ig-like (immunoglobulin-like) domain.
    • Cellular localization

      Cytoplasm > cytoskeleton. Cell junction > adherens junction. Cytoplasm > myofibril > sarcomere > Z line. Localizes to the cell-matrix AJ. Not found at the cell-cell AJ.
    • Information by UniProt
    • Database links

    • Alternative names

      • 1110046H09Rik antibody
      • AA553326 antibody
      • F-actin binding protein antibody
      • F-actin-binding protein antibody
      • MGC104234 antibody
      • MGC138865 antibody
      • MGC138866 antibody
      • Nelin antibody
      • Nexilin antibody
      • Nexn antibody
      • NEXN_HUMAN antibody
      • nF actin binding protein antibody
      • OTTHUMP00000038336 antibody
      see all

    Images

    • Lane 1: Immunoprecipitation of 293T whole cell lysate, 1 mg total protein for the IP, 20% of IP loaded. Affinity purified rabbit anti-Nexillin antibody ab140435 was used for the IP at 6 μg/mg lysate. Detection was with another Nexilin/F-actin-binding protein rabbit polyclonal antibody, currently unavailable. Lane 2 was loaded with control IgG IP product.

    References

    ab140435 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab140435.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up