Overview

  • Product name

    Anti-NF2 / Merlin antibody
    See all NF2 / Merlin primary antibodies
  • Description

    Rabbit polyclonal to NF2 / Merlin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Fusion protein corresponding to Human NF2/ Merlin aa 19-595. NP_000259.1
    Sequence:

    PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTI KDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLF FLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEEL LPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYG VNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSD KEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEV QQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEAT MANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIR TEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRA KQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLS MEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDR GGSSKHNTIKKLTLQSAKSRVAFFEEL


    Database link: P35240

  • Positive control

    • WB: HeLa, HEK-293T and HepG2 whole cell lysate. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab238520 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 70 kDa.
ICC/IF 1/20 - 1/100.

Target

  • Function

    Probable regulator of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway, a signaling pathway that plays a pivotal role in tumor suppression by restricting proliferation and promoting apoptosis. Along with WWC1 can synergistically induce the phosphorylation of LATS1 and LATS2 and can probably function in the regulation of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway. May act as a membrane stabilizing protein. May inhibit PI3 kinase by binding to AGAP2 and impairing its stimulating activity. Suppresses cell proliferation and tumorigenesis by inhibiting the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex.
  • Tissue specificity

    Widely expressed. Isoform 1 and isoform 3 are predominant. Isoform 4, isoform 5 and isoform 6 are expressed moderately. Isoform 8 is found at low frequency. Isoform 7, isoform 9 and isoform 10 are not expressed in adult tissues, with the exception of adult retina expressing isoform 10. Isoform 9 is faintly expressed in fetal brain, heart, lung, skeletal muscle and spleen. Fetal thymus expresses isoforms 1, 7, 9 and 10 at similar levels.
  • Involvement in disease

    Defects in NF2 are the cause of neurofibromatosis 2 (NF2) [MIM:101000]; also known as central neurofibromatosis. NF2 is a genetic disorder characterized by bilateral vestibular schwannomas (formerly called acoustic neuromas), schwannomas of other cranial and peripheral nerves, meningiomas, and ependymomas. It is inherited in an autosomal dominant fashion with full penetrance. Affected individuals generally develop symptoms of eighth-nerve dysfunction in early adulthood, including deafness and balance disorder. Although the tumors of NF2 are histologically benign, their anatomic location makes management difficult, and patients suffer great morbidity and mortality.
    Defects in NF2 are a cause of schwannomatosis (SCHWA) [MIM:162091]; also known as congenital cutaneous neurilemmomatosis. Schwannomas are benign tumors of the peripheral nerve sheath that usually occur singly in otherwise normal individuals. Multiple schwannomas in the same individual suggest an underlying tumor-predisposition syndrome. The most common such syndrome is NF2. The hallmark of NF2 is the development of bilateral vestibular-nerve schwannomas; but two-thirds or more of all NF2-affected individuals develop schwannomas in other locations, and dermal schwannomas may precede vestibular tumors in NF2-affected children. There have been several reports of individuals with multiple schwannomas who do not show evidence of vestibular schwannoma. Clinical report suggests that schwannomatosis is a clinical entity distinct from other forms of neurofibromatosis.
  • Sequence similarities

    Contains 1 FERM domain.
  • Post-translational
    modifications

    Phosphorylation of Ser-518 inhibits nuclear localization by disrupting the intramolecular association of the FERM domain with the C-terminal tail.
    Ubiquitinated by the CUL4A-RBX1-DDB1-DCAF1/VprBP E3 ubiquitin-protein ligase complex for ubiquitination and subsequent proteasome-dependent degradation.
  • Cellular localization

    Cytoplasm > perinuclear region. Cytoplasmic granule. Observed in cytoplasmic granules concentrated in a perinuclear location. Isoform 7 is absent from ruffling membranes and filopodia; Cytoplasm > perinuclear region. Cytoplasmic granule. Observed in cytoplasmic granules concentrated in a perinuclear location. Isoform 9 is absent from ruffling membranes and filopodia; Nucleus. Cell projection > filopodium membrane. Cell projection > ruffle membrane. Cytoplasm > perinuclear region. Cytoplasmic granule. Cytoplasm > cytoskeleton. In a fibroblastic cell line, isoform 10 is found homogeneously distributed over the entire cell, with a particularly strong staining in ruffling membranes and filopodia and Cell projection > filopodium membrane. Cell projection > ruffle membrane. Nucleus. In a fibroblastic cell line, isoform 1 is found homogeneously distributed over the entire cell, with a particularly strong staining in ruffling membranes and filopodia. Colocalizes with MPP1 in non-myelin-forming Schwann cells. Binds with VPRBP in the nucleus. The intramolecular association of the FERM domain with the C-terminal tail promotes nuclear accumulation. The unphosphorylated form accumulates predominantly in the nucleus while the phosphorylated form is largely confined to the non-nuclear fractions.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACN antibody
    • BANF antibody
    • Bilateral acoustic neuroma antibody
    • MERL_HUMAN antibody
    • Merlin antibody
    • Moesin ezrin radixin like protein antibody
    • Moesin ezrin radizin like antibody
    • Moesin-ezrin-radixin-like protein antibody
    • Neurofibromatosis 2 antibody
    • Neurofibromatosis type 2 antibody
    • Neurofibromatosis2 antibody
    • Neurofibromin 2 antibody
    • Neurofibromin-2 antibody
    • Neurofibromin2 antibody
    • NF 2 antibody
    • Nf2 antibody
    • SCH antibody
    • Schwannomerlin antibody
    • Schwannomin antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for NF2 / Merlin (Green) using ab238520 at 1/20 dilution in ICC/IF. Nuclear counterstain is DAPI (Blue).

  • All lanes : Anti-NF2 / Merlin antibody (ab238520) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution

    Predicted band size: 70 kDa



    Blocking buffer: 3% non-fat dry milk in TBST.

References

ab238520 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238520.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up