Overview

  • Product name

    Anti-NFAM1 antibody
  • Description

    Rabbit polyclonal to NFAM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human NFAM1 aa 100-150 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    HPGLGTENQSHTLDCQVTLVLPGASATGTYYCSVHWPHSTVRGSGTFILV R


    Database link: Q8NET5

  • Positive control

    • Human lung carcinoma tissue; Mouse splenocytes

Properties

Applications

Our Abpromise guarantee covers the use of ab203206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 30 kDa.
Flow Cyt 1/20 - 1/100.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 with fluorescent detection methods.

Target

  • Relevance

    NFAM1 activates cytokine gene promoters such as the IL13 and TNF-alpha promoters. It contains an immunoreceptor tyrosine-based activation motif (ITAM) and is thought to regulate the signaling and development of B-cells.
  • Cellular localization

    Type I membrane protein.
  • Database links

  • Alternative names

    • Calcinerin/NFAT activating ITAM containing protein antibody
    • CNAIP antibody
    • NFAT activation molecule 1 precursor antibody

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin embedded Human lung carcinoma tissue labeling NFAM1 using ab203206 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Flow cytometry analysis of Mouse splenocytes labeling NFAM1 using ab203206 at 1/100 dilution for 40 minutes (green) followed by a FITC conjugated secondary compared to control cells (blue).

References

ab203206 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203206.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up