Overview

  • Product name

  • Description

    Rabbit polyclonal to NFAT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NFAT1 aa 29-155.
    Sequence:

    DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASL SGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPL RMRDAGLLVEQPPLAGVAASPRFTLPV


    Database link: Q13469

  • Positive control

    • WB: Human liver tissue lysate. IHC-P: Human lymph node and duodenum tissue. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244310 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 100 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF.
  • Tissue specificity

    Expressed in thymus, spleen, heart, testis, brain, placenta, muscle and pancreas.
  • Sequence similarities

    Contains 1 RHD (Rel-like) domain.
  • Domain

    Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.
  • Post-translational
    modifications

    In resting cells, phosphorylated by NFATC-kinase on at least 18 sites in the 99-363 region. Upon cell stimulation, all these sites except Ser-243 are dephosphorylated by calcineurin. Dephosphorylation induces a conformational change that simultaneously exposes an NLS and masks an NES, which results in nuclear localization. Simultaneously, Ser-53 or Ser-56 is phosphorylated; which is required for full transcriptional activity.
  • Cellular localization

    Cytoplasm. Nucleus. Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI607462 antibody
    • cytoplasmic 2 antibody
    • KIAA0611 antibody
    • NF ATc2 antibody
    • NF ATp antibody
    • NF-ATc2 antibody
    • NF-ATp antibody
    • NFAC2_HUMAN antibody
    • NFAT 1 antibody
    • NFAT pre existing subunit antibody
    • NFAT pre-existing subunit antibody
    • NFAT transcription complex, preexisting component antibody
    • NFAT1 antibody
    • NFAT1-D antibody
    • NFATc2 antibody
    • NFATp antibody
    • Nuclear factor of activated T cells cytoplasmic 2 antibody
    • Nuclear factor of activated T cells cytoplasmic calcineurin dependent 2 antibody
    • Nuclear factor of activated T cells pre-existing component antibody
    • Nuclear factor of activated T cells, preexisting component antibody
    • Nuclear factor of activated T-cells antibody
    • Preexisting nuclear factor of activated T cells 2 antibody
    • T cell transcription factor NFAT 1 antibody
    • T-cell transcription factor NFAT1 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for NFAT1 (green) using ab244310 at 4 µg/ml in ICC/IF.

  • Formalin-fixed, paraffin-embedded human duodenum tissue stained for NFAT1 using ab244310 at 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human skeletal muscle tissue stained for NFAT1 using ab244310 at 1/50 dilution in immunohistochemical analysis.

    No positivity in myocytes, as expected.

  • Anti-NFAT1 antibody (ab244310) at 0.4 µg/ml + Human liver tissue lysate

    Predicted band size: 100 kDa

  • Formalin-fixed, paraffin-embedded human lymph node tissue stained for NFAT1 using ab244310 at 1/50 dilution in immunohistochemical analysis.

References

ab244310 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244310.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up