Overview

  • Product name

  • Description

    Mouse polyclonal to NFAT5
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human NFAT5 aa 1-1484. Isoform B (NP_619727.1).
    Sequence:

    MSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTSSSPTIYSTSV TDSKAMQVESCSSAVGVSNRGVSEKQLTSNTVQQHPSTPKRHTVLYISPP PEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEV PRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGN SKAGNGTLENQKGTGVKKSPMLCGQYPVKSEGKELKIVVQPETQHRARYL TEGSRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQAC RVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEA RIGIAGSKKKSTRARLVFRVNIMRKDGSTLTLQTPSSPILCTQPAGVPEI LKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDME LFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDPAA AGALNVNVKKEISSPARPCSFEEAMKAMKTTGCNLDKVNIIPNALMTPLI PSSMIKSEDVTPMEVTAEKRSSTIFKTTKSVGSTQQTLENISNIAGNGSF SSPSSSHLPSENEKQQQIQPKAYNPETLTTIQTQDISQPGTFPAVSASSQ LPNSDALLQQATQFQTRETQSREILQSDGTVVNLSQLTEASQQQQQSPLQ EQAQTLQQQISSNIFPSPNSVSQLQNTIQQLQAGSFTGSTASGSSGSVDL VQQVLEAQQQLSSVLFSAPDGNENVQEQLSADIFQQVSQIQSGVSPGMFS STEPTVHTRPDNLLPGRAESVHPQSENTLSNQQQQQQQQQQVMESSAAMV MEMQQSICQAAAQIQSELFPSTASANGNLQQSPVYQQTSHMMSALSTNED MQMQCELFSSPPAVSGNETSTTTTQQVATPGTTMFQTSSSGDGEETGTQA KQIQNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNSGTQQQGNGLFQ QGNEMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSLFHSPN PIVHSQTSTTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPM NNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISHIQTPMLS QEQAQPPQQGLFQPQVALGSLPPNPMPQSQQGTMFQSQHSIVAMQSNSPS QEQQQQQQQQQQQQQQQQQSILFSNQNTMATMASPKQPPPNMIFNPNQNP MANQEQQNQSIFHQQSNMAPMNQEQQPMQFQSQSTVSSLQNPGPTQSESS QTPLFHSSPQIQLVQGSPSSQEQQVTLFLSPASMSALQTSINQQDMQQSP LYSPQNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMF LFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPE NSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF


    Database link: O94916-3

  • Positive control

    • NFAT5 transfected 293T lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172506 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 165 kDa.

Target

  • Function

    Plays a role in the inducible expression of genes. Regulates hypertonicity-induced cellular accumulation of osmolytes.
  • Tissue specificity

    Highest levels in skeletal muscle, brain, heart and peripheral blood leukocytes. Also expressed in placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon.
  • Sequence similarities

    Contains 1 RHD (Rel-like) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Glutamine rich protein H65 antibody
    • KIAA0827 antibody
    • NF AT5 antibody
    • NF-AT5 antibody
    • NFAT 5 antibody
    • NFAT L1 antibody
    • NFAT like protein 1 antibody
    • NFAT5 antibody
    • NFAT5_HUMAN antibody
    • NFATL 1 antibody
    • NFATL1 antibody
    • NFATZ antibody
    • Nuclear factor of activated T cells 5 antibody
    • Nuclear factor of activated T cells 5 tonicity responsive antibody
    • Nuclear factor of activated T cells antibody
    • Nuclear factor of activated T-cells 5 antibody
    • OREBP antibody
    • Osmotic response element binding protein antibody
    • T cell transcription factor NFAT 5 antibody
    • T cell transcription factor NFAT5 antibody
    • T-cell transcription factor NFAT5 antibody
    • TonE binding protein antibody
    • TonE-binding protein antibody
    • TonEBP antibody
    • Tonicity responsive enhancer binding protein antibody
    • Tonicity-responsive enhancer-binding protein antibody
    see all

Images

  • All lanes : Anti-NFAT5 antibody (ab172506) at 1 µg/ml

    Lane 1 : NFAT5 transfected 293T lysate
    Lane 2 : Non-transfected 293T lysate.

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 165 kDa

References

ab172506 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172506.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up