Overview

  • Product name

  • Description

    Rabbit polyclonal to NFAT5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide corresponding to Human NFAT5 aa 1171-1220. NP_006590.1
    Sequence:

    QSTSNSEQQAAFQQQAPISHIQTPMLSQEQAQPPQQGLFQPQVALGSLPP


    Database link: O94916

  • Positive control

    • Human spleen tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab189175 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
ELISA 1/1000.

Target

  • Function

    Plays a role in the inducible expression of genes. Regulates hypertonicity-induced cellular accumulation of osmolytes.
  • Tissue specificity

    Highest levels in skeletal muscle, brain, heart and peripheral blood leukocytes. Also expressed in placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon.
  • Sequence similarities

    Contains 1 RHD (Rel-like) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Glutamine rich protein H65 antibody
    • KIAA0827 antibody
    • NF AT5 antibody
    • NF-AT5 antibody
    • NFAT 5 antibody
    • NFAT L1 antibody
    • NFAT like protein 1 antibody
    • NFAT5 antibody
    • NFAT5_HUMAN antibody
    • NFATL 1 antibody
    • NFATL1 antibody
    • NFATZ antibody
    • Nuclear factor of activated T cells 5 antibody
    • Nuclear factor of activated T cells 5 tonicity responsive antibody
    • Nuclear factor of activated T cells antibody
    • Nuclear factor of activated T-cells 5 antibody
    • OREBP antibody
    • Osmotic response element binding protein antibody
    • T cell transcription factor NFAT 5 antibody
    • T cell transcription factor NFAT5 antibody
    • T-cell transcription factor NFAT5 antibody
    • TonE binding protein antibody
    • TonE-binding protein antibody
    • TonEBP antibody
    • Tonicity responsive enhancer binding protein antibody
    • Tonicity-responsive enhancer-binding protein antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human spleen tissue labeling NFATS5 with ab189175 at 10 µg/ml.

References

ab189175 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189175.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up