Overview

  • Product name

  • Description

    Rabbit polyclonal to NFIX/CTF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Rat NFIX/CTF aa 13-298. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    HPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLG EKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKG KIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLC VQPHHIGVTIKELDLYLAYFVHTPESGQSDSSNQQGDADIKPLPNGHLSF QDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNINQVTLG RRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGT


    Database link: F2Z3R4

  • Positive control

    • WB: Rat serum; Recombinant rat NFIX/CTF protein IHC-P: Rat skin tissue.
  • General notes

    Product previously known as Rabbit polyclonal to NFIX.

Properties

Applications

Our Abpromise guarantee covers the use of ab231324 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 49 kDa.

Target

  • Function

    Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
  • Sequence similarities

    Belongs to the CTF/NF-I family.
    Contains 1 CTF/NF-I DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCAAT box binding transcription factor antibody
    • CCAAT-box-binding transcription factor antibody
    • CTF antibody
    • NF-I/X antibody
    • NF1-X antibody
    • NF1A antibody
    • NF1X antibody
    • NFI X antibody
    • NFI-X antibody
    • NFI/X antibody
    • NFIX antibody
    • NFIX_HUMAN antibody
    • Nuclear factor 1 X type antibody
    • Nuclear factor 1 X-type antibody
    • Nuclear factor 1/X antibody
    • Nuclear factor I/X antibody
    • TGGCA binding protein antibody
    • TGGCA-binding protein antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat skin tissue stained for NFIX/CTF with ab231324 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-NFIX/CTF antibody (ab231324) at 1 µg/ml + Rat serum.

    Predicted band size: 49 kDa

  • Anti-NFIX/CTF antibody (ab231324) at 1 µg/ml + Recombinant rat NFIX protein

    Predicted band size: 49 kDa

References

ab231324 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231324.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up