Recombinant

Recombinant Anti-NFkB Inducing Kinase NIK antibody [3H31L48] (ab203568)

Overview

  • Product name

    Anti-NFkB Inducing Kinase NIK antibody [3H31L48]
    See all NFkB Inducing Kinase NIK primary antibodies
  • Description

    Rabbit monoclonal [3H31L48] to NFkB Inducing Kinase NIK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NIK aa 706-860.
    Sequence:

    TTGRAPKLQPPLPPEPPEPNKSPPLTLSKEESGMWEPLPLSSLEPAPARN PSSPERKATVPEQELQQLEIELFLNSLSQPFSLEEQEQILSCLSIDSLSL SDDSEKNPSKASQSSRDTLSSGVHSWSSQAEARSSSWNMVLARGRPTDTP SYFNG


    Database link: Q99558

  • Positive control

    • 293 cells transfected with NIK; FLAG tagged NIK transfected 293 lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab203568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 10 - 20 µg/ml. Predicted molecular weight: 104 kDa.
ICC/IF Use a concentration of 4 - 6 µg/ml.

Target

  • Function

    Lymphotoxin beta-activated kinase which seems to be exclusively involved in the activation of NF-kappa-B and its transcriptional activity. Promotes proteolytic processing of NFKB2/P100, which leads to activation of NF-kappa-B via the non-canonical pathway. Could act in a receptor-selective manner.
  • Tissue specificity

    Weakly expressed in testis, small intestine, spleen, thymus, peripheral blood leukocytes, prostate, ovary and colon.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated. Phosphorylation at Thr-559 is required to activates its kinase activity and 'Lys-63'-linked polyubiquitination. Phosphorylated by CHUK/IKKA leading to MAP3K14 destabilization.
    Ubiquitinated. Undergoes both 'Lys-48'- and 'Lys-63'-linked polyubiquitination. 'Lys-48'-linked polyubiquitination leads to its degradation by the proteasome, while 'Lys-63'-linked polyubiquitination stabilizes and activates it.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • MAP3K14 antibody
    • FTDCR1B antibody
    • HS antibody
    • HsNIK antibody
    • M3K14_HUMAN antibody
    • Map3k14 antibody
    • Mitogen activated protein kinase kinase kinase 14 antibody
    • Mitogen-activated protein kinase kinase kinase 14 antibody
    • NF kappa beta inducing kinase antibody
    • NF-kappa-beta-inducing kinase antibody
    • NIK antibody
    • Serine/threonine-protein kinase NIK antibody
    see all

Images

  • Lane 1 : anti FLAG tag antibody
    Lane 2 : Anti-NFkB Inducing Kinase NIK antibody [3H31L48] (ab203568) at 15 µg/ml

    All lanes : Flag tagged NIK transfected 293 cell lysate

    Predicted band size: 104 kDa

  • Immunohistochemical analysis of non-transfected (left) and NIK transfected 293 cells (right) labeling NIK using ab203568 at 5 μg/mL. Alexa Fluor® 488 Goat anti-Rabbit at 1/1000 dilution was used as secondary antibody (green). Hoescht staining of nucleus (blue).

References

This product has been referenced in:

  • Li XJ  et al. Bergapten exerts inhibitory effects on diabetes-related osteoporosis via the regulation of the PI3K/AKT, JNK/MAPK and NF-?B signaling pathways in osteoprotegerin knockout mice. Int J Mol Med N/A:N/A (2016). WB ; Mouse . Read more (PubMed: 27840967) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up