Overview

  • Product name

  • Description

    Rabbit polyclonal to NFKBID
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human NFKBID aa 46-285. (Expressed in E.coli).
    Sequence:

    DEEGDTLLHLFAARGLRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAA NQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVD LEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQM GANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGN TALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPV


    Database link: Q8NI38

  • Positive control

    • IHC-P: Human liver and glioma tissues. WB: Recombinant human NFKBID protein; Human serum; Human liver lysate; Mouse kidney lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 33 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May regulate the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity. Functions in the regulation of inflammatory responses. May also regulate TCR-induced negative selection of thymocytes.
  • Sequence similarities

    Belongs to the NF-kappa-B inhibitor family.
    Contains 6 ANK repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • I-kappa-B-delta antibody
    • IkappaBdelta antibody
    • IkappaBNS antibody
    • IkB-delta antibody
    • IKBD_HUMAN antibody
    • IKBNS antibody
    • NF-kappa-B inhibitor delta antibody
    • NFKBID antibody
    • Nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor delta antibody
    • T-cell activation NFKB-like protein antibody
    • TA-NFKBH antibody
    see all

Images

  • All lanes : Anti-NFKBID antibody (ab232913) at 3 µg/ml

    Lane 1 : Human serum
    Lane 2 : Human liver lysate
    Lane 3 : Mouse kidney lysate
    Lane 4 : Human lung lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 33 kDa

  • Anti-NFKBID antibody (ab232913) at 5 µg/ml + Recombinant human NFKBID protein

    Predicted band size: 33 kDa

  • Paraffin-embedded human glioma tissue stained for NFKBID using ab232913 at 20 µg/ml in immunohistochemical analysis. DAB staining.  

  • Paraffin-embedded human liver tissue stained for NFKBID using ab232913 at 20 µg/ml in immunohistochemical analysis. DAB staining.  

References

ab232913 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232913.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up