Overview

  • Product name

  • Description

    Rabbit polyclonal to NFS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NFS1 aa 75-296. (BC065560).
    Sequence:

    DAMLPYLINYYGNPHSRTHAYGWESEAAMERARQQVASLIGADPREIIFT SGATESNNIAIKGVARFYRSRKKHLITTQTEHKCVLDSCRSLEAEGFQVT YLPVQKSGIIDLKELEAAIQPDTSLVSVMTVNNEIGVKQPIAEIGRICSS RKVYFHTDAAQAVGKIPLDVNDMKIDLMSISGHKIYGPKGVGAIYIRRRP RVRVEALQSGGGQERGMRSGTV


    Database link: Q9Y697

  • Positive control

    • HepG2, HEK293 and K562 cell lysates; Human brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab197253 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 50 kDa.

Target

  • Function

    Catalyzes the removal of elemental sulfur from cysteine to produce alanine. It supplies the inorganic sulfur for iron-sulfur (Fe-S) clusters. May be involved in the biosynthesis of molybdenum cofactor.
  • Tissue specificity

    Predominantly expressed in heart and skeletal muscle. Also found in brain, liver and pancreas.
  • Sequence similarities

    Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.
  • Cellular localization

    Cytoplasm. Nucleus and Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cysteine desulfurase antibody
    • Cysteine desulfurase, mitochondrial antibody
    • HUSSY 08 antibody
    • IscS antibody
    • mitochondrial antibody
    • NFS1 antibody
    • NFS1 nitrogen fixation 1 antibody
    • NFS1 nitrogen fixation 1 homolog (S. cerevisiae) antibody
    • NFS1_HUMAN antibody
    • NIFS antibody
    • nitrogen fixation 1 (S. cerevisiae, homolog) antibody
    • nitrogen fixation gene 1 antibody
    • nitrogen-fixing bacteria S, homolog of antibody
    • nitrogen-fixing bacteria S-like protein antibody
    • OTTHUMP00000030799 antibody
    see all

Images

  • All lanes : Anti-NFS1 antibody (ab197253) at 1/500 dilution

    Lane 1 : HepG2 cell lysate
    Lane 2 : HEK293 cell lysate
    Lane 3 : K562 cell lysate

    Predicted band size: 50 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human brain tissue labeling NFS1 with ab197253 at 1/100 dilution.

References

ab197253 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197253.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up