Overview

  • Product name

  • Description

    Rabbit polyclonal to NFX1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human NFX1 aa 668-803.
    Sequence:

    KELPCTSLKSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGR KLRCGLHRCEEPCHRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPE CTQTCARVHECDHPVYHSCHSEEKCPPCTFLTQKWC


    Database link: Q12986

  • Positive control

    • ICC/IF: SiHa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222334 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    NFX1 is a transcriptional repressor capable of binding to the conserved X box motif of HLA-DRA and other MHC class II genes in vitro. It may play a role in the inflammatory response, regulating its duration by limiting the period in which class II MHC molecules are induced by IFN gamma. The RING type zinc finger domain interacts with an ubiquitin conjugating enzyme (E2) and facilitates ubiquitination.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • MGC20369 antibody
    • NFX 1 antibody
    • NFX1 antibody
    • NFX2 antibody
    • Nuclear transcription factor X box binding 1 antibody
    • Nuclear transcription factor X box binding protein 1 antibody
    • Transcriptional repressor NF X1 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized SiHa cells stained for NFX1 (green) using ab222334 at 4 µg/ml in ICC/IF.

References

ab222334 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222334.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up