Overview

  • Product name

  • Description

    Rabbit polyclonal to NFYB/CBF-B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human NFYB/CBF-B aa 1-207.
    Sequence:

    MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKE SFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSE ASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKG IGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISG VQQIQFS


    Database link: P25208

  • Positive control

    • IHC-P: Human small intestine and thymus tissues.
  • General notes

     This product was previously labelled as NFYB

     

Properties

Applications

Our Abpromise guarantee covers the use of ab230040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human small intestine tissue stained for NFYB/CBF-B using ab230040 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thymus tissue stained for NFYB/CBF-B using ab230040 at 1/100 dilution in immunohistochemical analysis.

References

ab230040 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up