Overview

  • Product name

  • Description

    Rabbit polyclonal to NFYC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NFYC aa 140-275.
    Sequence:

    EPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTT PVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQI PVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQ


    Database link: Q13952

  • Positive control

    • PC3 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220748 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.
  • Sequence similarities

    Belongs to the NFYC/HAP5 subunit family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAAT box DNA binding protein subunit C antibody
    • CAAT box DNA-binding protein subunit C antibody
    • CBF C antibody
    • CBFC antibody
    • CCAAT binding factor subunit C antibody
    • CCAAT transcription binding factor subunit gamma antibody
    • DKFZp667G242 antibody
    • FLJ45775 antibody
    • H1TF2A antibody
    • HAP5 antibody
    • histone H1 transcription factor large subunit 2A antibody
    • HSM antibody
    • NF-YC antibody
    • NFYC antibody
    • NFYC_HUMAN antibody
    • Nuclear transcription factor Y gamma antibody
    • Nuclear transcription factor Y subunit C antibody
    • Nuclear transcription factor Y subunit gamma antibody
    • OTTHUMP00000009207 antibody
    • OTTHUMP00000009208 antibody
    • OTTHUMP00000009209 antibody
    • OTTHUMP00000009210 antibody
    • OTTHUMP00000009211 antibody
    • OTTHUMP00000009212 antibody
    • OTTHUMP00000009213 antibody
    • OTTHUMP00000009215 antibody
    • OTTHUMP00000009217 antibody
    • OTTHUMP00000231028 antibody
    • Transactivator HSM 1/2 antibody
    • transactivator HSM-1 antibody
    • Transactivator HSM-1/2 antibody
    see all

Images

  • Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100 permeabilized PC3 cells labeling NFYC with ab220748 at 4 μg/ml dilution  (green).

References

ab220748 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220748.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up