Overview

  • Product name

  • Description

    Rabbit polyclonal to NFYC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NFYC aa 1-263. Two N-terminal tags, His-tag and GST-tag. (Expresses in E.coli).
    Sequence:

    MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKK IMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRND IAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQ QPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQ VQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQY IRLAQPVSGTQVV


    Database link: Q13952-1

  • Positive control

    • IHC-P: Human liver tissue. WB: Recombinant human NFYC protein; HeLa whole cell lysate (ab150035).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 50 kDa.

Target

  • Function

    Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes.
  • Sequence similarities

    Belongs to the NFYC/HAP5 subunit family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAAT box DNA binding protein subunit C antibody
    • CAAT box DNA-binding protein subunit C antibody
    • CBF C antibody
    • CBFC antibody
    • CCAAT binding factor subunit C antibody
    • CCAAT transcription binding factor subunit gamma antibody
    • DKFZp667G242 antibody
    • FLJ45775 antibody
    • H1TF2A antibody
    • HAP5 antibody
    • histone H1 transcription factor large subunit 2A antibody
    • HSM antibody
    • NF-YC antibody
    • NFYC antibody
    • NFYC_HUMAN antibody
    • Nuclear transcription factor Y gamma antibody
    • Nuclear transcription factor Y subunit C antibody
    • Nuclear transcription factor Y subunit gamma antibody
    • OTTHUMP00000009207 antibody
    • OTTHUMP00000009208 antibody
    • OTTHUMP00000009209 antibody
    • OTTHUMP00000009210 antibody
    • OTTHUMP00000009211 antibody
    • OTTHUMP00000009212 antibody
    • OTTHUMP00000009213 antibody
    • OTTHUMP00000009215 antibody
    • OTTHUMP00000009217 antibody
    • OTTHUMP00000231028 antibody
    • Transactivator HSM 1/2 antibody
    • transactivator HSM-1 antibody
    • Transactivator HSM-1/2 antibody
    see all

Images

  • Anti-NFYC antibody (ab232909) at 2 µg/ml + Recombinant human NFYC protein.

    Predicted band size: 50 kDa

  • Anti-NFYC antibody (ab232909) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate.

    Predicted band size: 50 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for NFYC using ab232909 at 20μg/ml in immunohistochemical analysis. DAB staining.

References

ab232909 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Entamoeba invadens Cell lysate - nuclear (Cyst)
Gel Running Conditions
Reduced Denaturing (4-15)
Loading amount
40 µg
Specification
Cyst
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 0.5µg/mL · Temperature: 27°C

Dipak Manna

Verified customer

Submitted Nov 15 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up