Overview

  • Product name

  • Description

    Rabbit polyclonal to NGF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human NGF aa 150-200 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    TDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNS Y


    Database link: P01138

  • Positive control

    • Rat and Mouse brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab216419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI (PubMed:20164177).
  • Involvement in disease

    Neuropathy, hereditary sensory and autonomic, 5
  • Sequence similarities

    Belongs to the NGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta nerve growth factor antibody
    • Beta NGF antibody
    • Beta-nerve growth factor antibody
    • Beta-NGF antibody
    • HSAN5 antibody
    • MGC161426 antibody
    • MGC161428 antibody
    • Nerve growth factor (beta polypeptide) antibody
    • Nerve growth factor antibody
    • Nerve growth factor beta antibody
    • Nerve growth factor beta polypeptide antibody
    • Nerve growth factor beta subunit antibody
    • NGF antibody
    • NGF_HUMAN antibody
    • NGFB antibody
    • NID67 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat brain tissue labeling NGF with ab216419 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse brain tissue labeling NGF with ab216419 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab216419 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Rat Tissue sections (Nerve)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: pH 9.0 EDTA
Permeabilization
No
Specification
Nerve
Blocking step
PB ab64226 as blocking agent for 10 minute(s) · Concentration: 1% · Temperature: RT°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Dec 08 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up