Anti-NGX6 antibody - N-terminal (ab185376)
Key features and details
- Rabbit polyclonal to NGX6 - N-terminal
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-NGX6 antibody - N-terminal -
Description
Rabbit polyclonal to NGX6 - N-terminal -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow -
Immunogen
Recombinant fragment corresponding to Human NGX6 aa 1-80 (N terminal).
Sequence:MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFS VHFYIFFGPSVALPPERPAVFAMRLLPVLD
Database link: A6NDV4 -
Positive control
- Human appendix tissue.
-
General notes
Previously labelled as C9orf127.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab185376 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May function as a regulator of the EGFR pathway. Probable tumor suppressor which may function in cell growth, proliferation and adhesion. -
Sequence similarities
Belongs to the TMEM8 family.
Contains 1 EGF-like domain. -
Post-translational
modificationsIsoform 2 is N-glycosylated. -
Cellular localization
Cell membrane. Cytoplasm. Nucleus. Mitochondrion. Endoplasmic reticulum. Also detected in mitochondrion and endoplasmic reticulum. - Information by UniProt
-
Database links
- Entrez Gene: 100125302 Cow
- Entrez Gene: 51754 Human
- Entrez Gene: 242409 Mouse
- Entrez Gene: 313490 Rat
- SwissProt: A6QLK4 Cow
- SwissProt: A6NDV4 Human
- SwissProt: B1AWJ5 Mouse
- Unigene: 493808 Human
see all -
Alternative names
- C9orf127 antibody
- chromosome 9 open reading frame 127 antibody
- MGC120460 antibody
see all
Images
Datasheets and documents
References (0)
ab185376 has not yet been referenced specifically in any publications.