Overview

  • Product name

  • Description

    Rabbit polyclonal to NHE-6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human NHE-6 aa 495-533.
    Sequence:

    GGTTAMLSCLHIRVGVDSDQEHLGVPENERRTTKAESAW


    Database link: Q92581

  • Positive control

    • Human cerebral cortex tissue; U-2 OS cells.
  • General notes

    Previously labelled as SLC9A6. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Electroneutral exchange of protons for Na(+) and K(+) across the early and recycling endosome membranes. Contributes to calcium homeostasis.
  • Tissue specificity

    Ubiquitous; but is most abundant in mitochondrion-rich tissues such as brain, skeletal muscle and heart.
  • Involvement in disease

    Defects in SLC9A6 are the cause of mental retardation syndromic X-linked Christianson type (MRXSC) [MIM:300243]; also known as MRXS-Christianson or X-linked Angelman-like syndrome. The phenotype is characterized by profound mental retardation, epilepsy, ataxia, and microcephaly, and showed phenotypic overlap with Angelman syndrome.
  • Sequence similarities

    Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family.
  • Cellular localization

    Endosome membrane. Is present in the recycling compartments including early and recycling endosomes, and only appears transiently on the plasma membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3732426M05 antibody
    • 6430520C02Rik antibody
    • KIAA0267 antibody
    • mKIAA0267 antibody
    • MRSA antibody
    • Na(+)/H(+) exchanger 6 antibody
    • NHE-6 antibody
    • NHE6 antibody
    • OTTHUMP00000024089 antibody
    • OTTHUMP00000024090 antibody
    • RGD1563582 antibody
    • RP11-274K13.1 antibody
    • RP23-105E2.4 antibody
    • SL9A6_HUMAN antibody
    • SLC9A6 antibody
    • Sodium/hydrogen exchanger 6 antibody
    • Solute carrier family 9 (sodium/hydrogen exchanger), isoform 6 antibody
    • Solute carrier family 9 (sodium/hydrogen exchanger), member 6 antibody
    • Solute carrier family 9 member 6 antibody
    • solute carrier family 9, subfamily A (NHE6, cation proton antiporter 6), member 6 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue, labeling NHE-6 with ab204785 at 1/50 dilution.

  • Immunofluorescent analysis of U-2 OS cells (PFA-fixed/Triton X-100 permeabilized) labeling NHE-6 with ab204785 at 4 µg/ml (green).

References

ab204785 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up