Overview

  • Product name

  • Description

    Rabbit polyclonal to NHE-7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Guinea pig, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human NHE-7 aa 29-78.
    Sequence:

    LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI

  • Positive control

    • Jurkat cell lysate.
  • General notes

    Previously labelled as SLC9A7. 

Properties

Applications

Our Abpromise guarantee covers the use of ab75184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 80 kDa (predicted molecular weight: 80 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

  • Function

    Mediates electroneutral exchange of protons for Na(+) and K(+) across endomembranes. May contribute to Golgi volume and cation homeostasis.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family.
  • Cellular localization

    Golgi apparatus, trans-Golgi network membrane. Recycling endosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Na(+)/H(+) exchanger 7 antibody
    • NHE-7 antibody
    • NHE7 antibody
    • Nonselective sodium potassium/proton exchanger antibody
    • SL9A7_HUMAN antibody
    • SLC9A6 antibody
    • SLC9A7 antibody
    • Sodium/hydrogen exchanger 7 antibody
    • Solute carrier family 9 (sodium/hydrogen exchanger), member 7 antibody
    • Solute carrier family 9 member 7 antibody
    • Solute carrier family 9, isoform 7 antibody
    • Solute carrier family 9, member 7 antibody
    see all

Images

  • Anti-NHE-7 antibody (ab75184) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 80 kDa
    Observed band size: 80 kDa
    Additional bands at: 50 kDa. We are unsure as to the identity of these extra bands.



    Gel concentration: 12%

References

ab75184 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab75184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up