Anti-NHERF-2/SIP-1 antibody [32B6] (ab151443)
Key features and details
- Mouse monoclonal [32B6] to NHERF-2/SIP-1
- Suitable for: WB
- Knockout validated
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-NHERF-2/SIP-1 antibody [32B6]
See all NHERF-2/SIP-1 primary antibodies -
Description
Mouse monoclonal [32B6] to NHERF-2/SIP-1 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Full length protein corresponding to Human NHERF-2/SIP-1.
Sequence:MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAAL RAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQ LTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPR LCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVN GQNVEGLRHAEVVASIKAREDEARLLVVDPETDEHFKRLRVTPTEEHVEG PLPSPVTNGTSPAQLNGGSACSSRSDLPGSDKDTEDGSAWKQDPFQESGL HLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIFSNF
-
Positive control
- WB: HEK293T, MCF7, T-47D and HaCat cell lysates.
-
General notes
Previously labelled as SLC9A3R2.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
Preservative: 0.1% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
32B6 -
Myeloma
NS1 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
KO cell lines
-
KO cell lysates
Applications
Our Abpromise guarantee covers the use of ab151443 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/100. Predicted molecular weight: 37 kDa. |
Target
-
Function
Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. May also act as scaffold protein in the nucleus. -
Tissue specificity
Widely expressed. -
Sequence similarities
Contains 2 PDZ (DHR) domains. -
Cellular localization
Endomembrane system. Nucleus. Apical cell membrane. Localizes with EZR and PODXL at the apical cell membrane of glomerular epithelium cells and the sides of the food processes (By similarity). Nuclear, in a punctate pattern. - Information by UniProt
-
Database links
- Entrez Gene: 9351 Human
- Entrez Gene: 65962 Mouse
- Entrez Gene: 116501 Rat
- Omim: 606553 Human
- SwissProt: Q15599 Human
- SwissProt: Q9JHL1 Mouse
- SwissProt: Q920G2 Rat
- Unigene: 440896 Human
see all -
Alternative names
- E3KARP antibody
- HGNC:11076 antibody
- Isoform 3 regulator 2 antibody
see all
Images
-
All lanes : Anti-NHERF-2/SIP-1 antibody [32B6] (ab151443) at 1/500 dilution
Lane 1 : Wild-type HEK293T cell lysate
Lane 2 : SLC9A3R2 knockout HEK293T cell lysate
Lane 3 : MCF7 cell lysate
Lane 4 : T-47D cell lysate
Lysates/proteins at 20 µg per lane.
Secondary
All lanes : Goat Anti-Rabbit IgG H&L (IRDye® 680RD) preadsorbed (ab216777) at 1/10000 dilution
Predicted band size: 37 kDa
Observed band size: 45 kDa why is the actual band size different from the predicted?Lanes 1-4: Merged signal (red and green). Green - ab151443 observed at 45 kDa. Red - loading control ab52901 observed at kDa.
ab151443 Anti-NHERF-2/SIP-1 antibody [32B6] was shown to specifically react with NHERF-2/SIP-1 in wild-type HEK293T cells. Loss of signal was observed when knockout cell line ab266778 (knockout cell lysate ab258685) was used. Wild-type and NHERF-2/SIP-1 knockout samples were subjected to SDS-PAGE. ab151443 and Anti-beta Tubulin [EP1331Y] - Microtubule Marker (ab52901) were incubated overnight at 4°C at 1 in 500 dilution and 1 in 20000 dilution respectively. Blots were developed with Goat anti-Rabbit IgG H&L (IRDye® 680RD) preadsorbed (ab216777) and Goat anti-Mouse IgG H&L (IRDye® 800CW) preadsorbed (ab216772) secondary antibodies at 1 in 20000 dilution for 1 hour at room temperature before imaging.
-
Anti-NHERF-2/SIP-1 antibody [32B6] (ab151443) at 1/100 dilution + HaCat Human keratinocyte cells
Predicted band size: 37 kDa
References (0)
ab151443 has not yet been referenced specifically in any publications.