For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    nherf-2sip-1-antibody-32b6-ab151443.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Cytoskeleton / ECM Cytoskeleton Microfilaments Actin etc Actin Binding Proteins
Share by email
Validated using a knockout cell line

Anti-NHERF-2/SIP-1 antibody [32B6] (ab151443)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-NHERF-2/SIP-1 antibody [32B6] (ab151443)
  • Western blot - Anti-NHERF-2/SIP-1 antibody [32B6] (ab151443)

Key features and details

  • Mouse monoclonal [32B6] to NHERF-2/SIP-1
  • Suitable for: WB
  • Knockout validated
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)
Knockout
Product image
Human SLC9A3R2 (NHERF-2/SIP-1) knockout HEK293T cell line (ab266778)

View more associated products

Overview

  • Product name

    Anti-NHERF-2/SIP-1 antibody [32B6]
    See all NHERF-2/SIP-1 primary antibodies
  • Description

    Mouse monoclonal [32B6] to NHERF-2/SIP-1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Full length protein corresponding to Human NHERF-2/SIP-1.
    Sequence:

    MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAAL RAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQ LTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPR LCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVN GQNVEGLRHAEVVASIKAREDEARLLVVDPETDEHFKRLRVTPTEEHVEG PLPSPVTNGTSPAQLNGGSACSSRSDLPGSDKDTEDGSAWKQDPFQESGL HLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIFSNF

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEK293T, MCF7, T-47D and HaCat cell lysates.
  • General notes

    Previously labelled as SLC9A3R2. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.1% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    32B6
  • Myeloma

    NS1
  • Isotype

    IgG1
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Cytoskeleton
    • Microfilaments
    • Actin etc
    • Actin Binding Proteins
    • Signal Transduction
    • Metabolism
    • Plasma Membrane
    • Channels

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
  • KO cell lines

    • Human SLC9A3R2 (NHERF-2/SIP-1) knockout HEK293T cell line (ab266778)
  • KO cell lysates

    • Human SLC9A3R2 (NHERF-2/SIP-1) knockout HEK293T cell lysate (ab258685)

Applications

Our Abpromise guarantee covers the use of ab151443 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100. Predicted molecular weight: 37 kDa.

Target

  • Function

    Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. May also act as scaffold protein in the nucleus.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Contains 2 PDZ (DHR) domains.
  • Cellular localization

    Endomembrane system. Nucleus. Apical cell membrane. Localizes with EZR and PODXL at the apical cell membrane of glomerular epithelium cells and the sides of the food processes (By similarity). Nuclear, in a punctate pattern.
  • Target information above from: UniProt accession Q15599 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 9351 Human
    • Entrez Gene: 65962 Mouse
    • Entrez Gene: 116501 Rat
    • Omim: 606553 Human
    • SwissProt: Q15599 Human
    • SwissProt: Q9JHL1 Mouse
    • SwissProt: Q920G2 Rat
    • Unigene: 440896 Human
    • Unigene: 21587 Mouse
    • Unigene: 39351 Rat
    see all
  • Alternative names

    • E3KARP antibody
    • HGNC:11076 antibody
    • Isoform 3 regulator 2 antibody
    • Isoform 3 regulatory factor 2 antibody
    • MGC104639 antibody
    • Na(+)/H(+) exchange regulatory cofactor NHE RF2 antibody
    • Na(+)/H(+) exchange regulatory cofactor NHE-RF2 antibody
    • NHE3 kinase A regulatory protein antibody
    • NHE3 kinase A regulatory protein E3KARP antibody
    • NHE3 regulatory factor 2 antibody
    • NHE3RF2 antibody
    • NHERF 2 antibody
    • NHERF-2 antibody
    • NHERF2 antibody
    • NHRF2_HUMAN antibody
    • OCTS2 antibody
    • SIP 1 antibody
    • SIP-1 antibody
    • SIP1 antibody
    • Slc9a3r2 antibody
    • Sodium hydrogen exchanger regulatory factor 2 antibody
    • Sodium-hydrogen exchanger regulatory factor 2 antibody
    • Sodium/hydrogen exchanger antibody
    • Sodium/hydrogen exchanger regulatory factor 2 antibody
    • Solute carrier family 9 (sodium/hydrogen exchanger) antibody
    • Solute carrier family 9 (sodium/hydrogen exchanger) isoform 3 regulator 2 antibody
    • Solute carrier family 9 (sodium/hydrogen exchanger) isoform 3 regulatory factor 2 antibody
    • Solute carrier family 9 (sodium/hydrogen exchanger) member 3 regulator 2 antibody
    • Solute carrier family 9 isoform 3 regulator 2 antibody
    • Solute carrier family 9 isoform A3 regulatory factor 2 antibody
    • SRY interacting protein 1 antibody
    • SRY-interacting protein 1 antibody
    • TKA 1 antibody
    • TKA-1 antibody
    • TKA1 antibody
    • Tyrosine kinase activator protein 1 antibody
    see all

Images

  • Western blot - Anti-NHERF-2/SIP-1 antibody [32B6] (ab151443)
    Western blot - Anti-NHERF-2/SIP-1 antibody [32B6] (ab151443)
    All lanes : Anti-NHERF-2/SIP-1 antibody [32B6] (ab151443) at 1/500 dilution

    Lane 1 : Wild-type HEK293T cell lysate
    Lane 2 : SLC9A3R2 knockout HEK293T cell lysate
    Lane 3 : MCF7 cell lysate
    Lane 4 : T-47D cell lysate

    Lysates/proteins at 20 µg per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG H&L (IRDye® 680RD) preadsorbed (ab216777) at 1/10000 dilution

    Predicted band size: 37 kDa
    Observed band size: 45 kDa
    why is the actual band size different from the predicted?



    Lanes 1-4: Merged signal (red and green). Green - ab151443 observed at 45 kDa. Red - loading control ab52901 observed at  kDa.

     ab151443 Anti-NHERF-2/SIP-1 antibody [32B6] was shown to specifically react with NHERF-2/SIP-1 in wild-type HEK293T cells. Loss of signal was observed when knockout cell line ab266778 (knockout cell lysate ab258685) was used. Wild-type and NHERF-2/SIP-1 knockout samples were subjected to SDS-PAGE. ab151443 and Anti-beta Tubulin [EP1331Y] - Microtubule Marker (ab52901) were incubated overnight at 4°C at 1 in 500 dilution and 1 in 20000 dilution respectively. Blots were developed with Goat anti-Rabbit IgG H&L (IRDye® 680RD) preadsorbed (ab216777) and Goat anti-Mouse IgG H&L (IRDye® 800CW) preadsorbed (ab216772) secondary antibodies at 1 in 20000 dilution for 1 hour at room temperature before imaging.

  • Western blot - Anti-NHERF-2/SIP-1 antibody [32B6] (ab151443)
    Western blot - Anti-NHERF-2/SIP-1 antibody [32B6] (ab151443)
    Anti-NHERF-2/SIP-1 antibody [32B6] (ab151443) at 1/100 dilution + HaCat Human keratinocyte cells

    Predicted band size: 37 kDa

Protocols

  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab151443? Please let us know so that we can cite the reference in this datasheet.

    ab151443 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab151443.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.