Overview

  • Product name

    Anti-NHERF-2/SIP-1 antibody
    See all NHERF-2/SIP-1 primary antibodies
  • Description

    Rabbit polyclonal to NHERF-2/SIP-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human NHERF-2/SIP-1 aa 56-337. Expressed in E.coli.
    Sequence:

    LVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTE EMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLR KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE GLRHAEVVASIKAREDEARLLVVDPETDEHFKRLRVTPTEEHVEGPLPSP VTNGTSPAQLNGGSACSSRSDLPGSDKDTEDGSAWKQDPFQESGLHLSPT AAEAKEKARAMRVNKRAPQMDWNRKREIFSNF


    Database link: Q15599

  • Positive control

    • WB: Recombinant human NHERF-2/SIP-1; Human lung lysate; Pig liver tissue lysate. IHC-P: Human colorectal cancer and breast cancer tissue.
  • General notes

    Previously labelled as SLC9A3R2

Properties

Applications

Our Abpromise guarantee covers the use of ab233167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 37 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. May also act as scaffold protein in the nucleus.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Contains 2 PDZ (DHR) domains.
  • Cellular localization

    Endomembrane system. Nucleus. Apical cell membrane. Localizes with EZR and PODXL at the apical cell membrane of glomerular epithelium cells and the sides of the food processes (By similarity). Nuclear, in a punctate pattern.
  • Information by UniProt
  • Database links

  • Alternative names

    • E3KARP antibody
    • HGNC:11076 antibody
    • Isoform 3 regulator 2 antibody
    • Isoform 3 regulatory factor 2 antibody
    • MGC104639 antibody
    • Na(+)/H(+) exchange regulatory cofactor NHE RF2 antibody
    • Na(+)/H(+) exchange regulatory cofactor NHE-RF2 antibody
    • NHE3 kinase A regulatory protein antibody
    • NHE3 kinase A regulatory protein E3KARP antibody
    • NHE3 regulatory factor 2 antibody
    • NHE3RF2 antibody
    • NHERF 2 antibody
    • NHERF-2 antibody
    • NHERF2 antibody
    • NHRF2_HUMAN antibody
    • OCTS2 antibody
    • SIP 1 antibody
    • SIP-1 antibody
    • SIP1 antibody
    • Slc9a3r2 antibody
    • Sodium hydrogen exchanger regulatory factor 2 antibody
    • Sodium-hydrogen exchanger regulatory factor 2 antibody
    • Sodium/hydrogen exchanger antibody
    • Sodium/hydrogen exchanger regulatory factor 2 antibody
    • Solute carrier family 9 (sodium/hydrogen exchanger) antibody
    • Solute carrier family 9 (sodium/hydrogen exchanger) isoform 3 regulator 2 antibody
    • Solute carrier family 9 (sodium/hydrogen exchanger) isoform 3 regulatory factor 2 antibody
    • Solute carrier family 9 (sodium/hydrogen exchanger) member 3 regulator 2 antibody
    • Solute carrier family 9 isoform 3 regulator 2 antibody
    • Solute carrier family 9 isoform A3 regulatory factor 2 antibody
    • SRY interacting protein 1 antibody
    • SRY-interacting protein 1 antibody
    • TKA 1 antibody
    • TKA-1 antibody
    • TKA1 antibody
    • Tyrosine kinase activator protein 1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for NHERF-2/SIP-1 using ab233167 at 20 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for NHERF-2/SIP-1 using ab233167 at 20 μg/ml in immunohistochemical analysis.

  • Anti-NHERF-2/SIP-1 antibody (ab233167) at 2 µg/ml + Recombinant human NHERF-2/SIP-1 protein

    Developed using the ECL technique.

    Predicted band size: 37 kDa

  • Anti-NHERF-2/SIP-1 antibody (ab233167) at 2 µg/ml + Human lung tissue lysate

    Predicted band size: 37 kDa

  • Anti-NHERF-2/SIP-1 antibody (ab233167) at 2 µg/ml + Pig liver tissue lysate

    Predicted band size: 37 kDa

References

ab233167 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up