Overview

  • Product name

    Anti-NHLRC1/Malin antibody
    See all NHLRC1/Malin primary antibodies
  • Description

    Rabbit polyclonal to NHLRC1/Malin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human NHLRC1/Malin aa 1-280.
    Sequence:

    MAAEASESGPALHELMREAEISLLECKVCFEKFGHRQQRRPRNLSCGHVV CLACVAALAHPRTLALECPFCRRACRGCDTSDCLPVLHLIELLGSALRQS PAAHRAAPSAPGALTCHHTFGGWGTLVNPTGLALCPKTGRVVVVHDGRRR VKIFDSGGGCAHQFGEKGDAAQDIRYPVDVTITNDCHVVVTDAGDRSIKV FDFFGQIKLVIGGQFSLPWGVETTPQNGIVVTDAEAGSLHLLDVDFAEGV LRRTERLQAHLCNPRGVAVSWLTGAIAVLE


    Database link: Q6VVB1

  • Positive control

    • WB: LO2 whole cell lysate; Rat liver lysate. IHC-P: Human heart and liver tissues.
  • General notes

     This product was previously labelled as NHLRC1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab225919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 42 kDa (predicted molecular weight: 42 kDa).

Target

  • Function

    E3 ubiquitin-protein ligase. Together with the phosphatase EPM2A/laforin, appears to be involved in the clearance of toxic polyglucosan and protein aggregates via multiple pathways. In complex with EPM2A/laforin and HSP70, suppresses the cellular toxicity of misfolded proteins by promoting their degradation through the ubiquitin-proteasome system (UPS). Ubiquitinates the glycogen-targeting protein phosphatase subunits PPP1R3C/PTG and PPP1R3D in a laforin-dependent manner and targets them for proteasome-dependent degradation, thus decreasing glycogen accumulation. Polyubiquitinates EPM2A/laforin and ubiquitinates AGL and targets them for proteasome-dependent degradation. Also promotes proteasome-independent protein degradation through the macroautophagy pathway.
  • Tissue specificity

    Expressed in brain, cerebellum, spinal cord, medulla, heart, liver, skeletal muscle and pancreas.
  • Pathway

    Protein modification; protein ubiquitination.
  • Involvement in disease

    Epilepsy, progressive myoclonic 2
  • Sequence similarities

    Contains 6 NHL repeats.
    Contains 1 RING-type zinc finger.
  • Domain

    The RING domain is essential for ubiquitin E3 ligase activity.
  • Cellular localization

    Endoplasmic reticulum. Nucleus. Localizes at the endoplasmic reticulum and, to a lesser extent, in the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA204B7.2 antibody
    • E3 ubiquitin-protein ligase NHLRC1 antibody
    • EPM2A antibody
    • EPM2B antibody
    • EPM2B gene antibody
    • Malin antibody
    • MGC119262 antibody
    • MGC119264 antibody
    • MGC119265 antibody
    • NHL repeat containing 1 antibody
    • NHL repeat containing E3 ubiquitin protein ligase 1 antibody
    • NHL repeat containing protein 1 antibody
    • NHL repeat-containing protein 1 antibody
    • NHL repeat-containing protein 1 gene antibody
    • NHLC1_HUMAN antibody
    • NHLRC 1 antibody
    • Nhlrc1 antibody
    see all

Images

  • Paraffin-embedded human heart tissue stained for NHLRC1/Malin using ab225919 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for NHLRC1/Malin using ab225919 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-NHLRC1/Malin antibody (ab225919) at 1/1000 dilution

    Lane 1 : LO2 whole cell lysate
    Lane 2 : Rat liver lysate

    Secondary
    All lanes : Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 42 kDa
    Observed band size: 42 kDa

References

ab225919 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up