Overview

  • Product name

  • Description

    Rabbit polyclonal to NHLRC2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human NHLRC2 aa 1-367.
    Sequence:

    MAGTHQIWALLLDSGKLPKKNELTKGTCLRFAGSGNEENRNNAYPHKAGF AQPSGLSLASEDPWSCLFVADSESSTVRTVSLKDGAVKHLVGGERDPMNL FAFGDVDGVGINAKLQHPLGVTWDKKRNLLYVADSYNHKIKVVDPKTKNC TTLAGTGDTNNVTSSSFTESTFNEPGGLCIGENGELLYVADTNNHQIKVM DLETKMVSVLPIFRSENAVVDGPFLVEKQKTLPKLPKSAPSIRLSPVTAC AGQTLQFKLRLDLPSGSKLTEGVSSCWFLTAEGNEWLLQGQIAAGDIENI SSQPTISLQIPDDCLSLEAIVSVSVFLYYCSADSSACMMKAILFSQPLQI TDTQQGCIAPVELRYVF


    Database link: Q8NBF2-2

  • Positive control

    • WB: U-251 MG whole cell lysate. IHC-P: Human small intestine and placenta tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 40, 79 kDa.
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Contains 6 NHL repeats.
    Contains 1 thioredoxin domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1200003G01Rik antibody
    • DKFZp779F115 antibody
    • FLJ20147 antibody
    • FLJ25621 antibody
    • FLJ33312 antibody
    • MGC45492 antibody
    • NHL repeat containing 2 antibody
    • NHL repeat-containing protein 2 antibody
    • NHLC2_HUMAN antibody
    • NHLRC2 antibody
    • Novel NHL repeat domain containing protein antibody
    • OTTHUMP00000020518 antibody
    see all

Images

  • Anti-NHLRC2 antibody (ab235426) at 1/500 dilution + U-251 MG (Human brain glioma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 40, 79 kDa

  • Paraffin-embedded human small intestine tissue stained for NHLRC2 with ab235426 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for NHLRC2 with ab235426 at 1/100 dilution in immunohistochemical analysis.

References

ab235426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up