Anti-NHP2 antibody (ab204352)
Key features and details
- Rabbit polyclonal to NHP2
- Suitable for: IHC-P, WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-NHP2 antibody
See all NHP2 primary antibodies -
Description
Rabbit polyclonal to NHP2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Orangutan -
Immunogen
Recombinant fragment corresponding to Human NHP2 aa 4-75.
Sequence:IKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKK AVKQKQIRRGVKEVQKFVNKGE
Database link: Q9NX24 -
Positive control
- Human hippocampus tissue; RT-4 cell lysate; MCF7 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab204352 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 17 kDa. | |
ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme. -
Tissue specificity
Expressed in brain, colon, heart, kidney, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus. Also expressed at lower levels in the liver. -
Involvement in disease
Dyskeratosis congenita, autosomal recessive, 2 -
Sequence similarities
Belongs to the ribosomal protein L7Ae family. -
Developmental stage
Transcript peaks at G1/S transition. -
Cellular localization
Nucleus > nucleolus. Nucleus > Cajal body. Also localized to Cajal bodies. - Information by UniProt
-
Database links
- Entrez Gene: 520891 Cow
- Entrez Gene: 55651 Human
- Entrez Gene: 52530 Mouse
- Entrez Gene: 100172250 Orangutan
- Entrez Gene: 287273 Rat
- Omim: 606470 Human
- SwissProt: Q5E950 Cow
- SwissProt: Q9NX24 Human
see all -
Alternative names
- DKCB2 antibody
- FLJ20479 antibody
- H/ACA ribonucleoprotein complex subunit 2 antibody
see all
Images
-
Anti-NHP2 antibody (ab204352) at 1/100 dilution + RT-4 cell lysate
Predicted band size: 17 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NHP2 antibody (ab204352)
Immunohistochemical analysis of paraffin-embedded Human hippocampus tissue labeling NHP2 with ab204352 at 1/500 dilution.
-
Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling NHP2 with ab204352 at 4 µg/ml (green).
Protocols
Datasheets and documents
References (0)
ab204352 has not yet been referenced specifically in any publications.