Overview

  • Product name

    Anti-NICN1 antibody
  • Description

    Rabbit polyclonal to NICN1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Dog
  • Immunogen

    Recombinant full length protein corresponding to Human NICN1 aa 1-213.
    Sequence:

    MSRVLVPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITF KNYYTAFLSIRVRQYTSAHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLF KHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGPKSPSVTFPKW LSHPVPCEQPALLREGLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFD VDGCYDLNLLSYT


    Database link: Q9BSH3-1

  • Positive control

    • WB: U-87 MG whole cell lysate. IHC-P: Human testis, kidney and lung tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235314 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 24 kDa.

Target

  • Relevance

    The function of NICN1 remains unknown. It is localized to the nucleus and is expressed in numerous tissues including brain, testis, liver, and kidney.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • Nicolin 1 antibody
    • NPCEDRG antibody
    • p24 antibody
    • PGs5 antibody
    • Tubulin polyglutamylase complex subunit 5 antibody
    see all

Images

  • Anti-NICN1 antibody (ab235314) at 1/1000 dilution + U-87 MG (Human glioblastoma-astrocytoma epithelial cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 24 kDa

  • Paraffin-embedded human testis tissue stained for NICN1 using ab235314 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for NICN1 using ab235314 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung tissue stained for NICN1 using ab235314 at 1/100 dilution in immunohistochemical analysis.

References

ab235314 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235314.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up