Overview

  • Product name

    Anti-Nidogen 2/NID-2 antibody
    See all Nidogen 2/NID-2 primary antibodies
  • Description

    Rabbit polyclonal to Nidogen 2/NID-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Nidogen 2/NID-2 aa 31-289. (Expressed in E.coli).
    Sequence:

    LHPDELFPHGESWGDQLLQEGDDESSAVVKLANPLHFYEARFSNLYVGTN GIISTQDFPRETQYVDYDFPTDFPAIAPFLADIDTSHGRGRVLYREDTSP AVLGLAARYVRAGFPRSARFTPTHAFLATWEQVGAYEEVKRGALPSGELN TFQAVLASDGSDSYALFLYPANGLQFLGTRPKESYNVQLQLPARVGFCRG EADDLKSEGPYFSLTSTEQSVKNLYQLSNLGIPGVWAFHIGSTSPLDNVR PAAVGDLSA


    Database link: Q14112

  • Positive control

    • IHC-P: Human breast cancer and stomach tissues. WB: Human lung lysate; Recombinant human Nidogen 2/NID-2 protein.
  • General notes

    Previously labelled as Nidogen 2. 

Properties

Applications

Our Abpromise guarantee covers the use of ab232883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 151 kDa.

Target

  • Function

    Cell adhesion glycoprotein which is widely distributed in basement membranes. Binds to collagens I and IV, to perlecan and to laminin 1. Does not bind fibulins. It probably has a role in cell-extracellular matrix interactions.
  • Tissue specificity

    Heart, placenta and bone. Less in pancreas, kidney and skeletal muscle.
  • Sequence similarities

    Contains 5 EGF-like domains.
    Contains 5 LDL-receptor class B repeats.
    Contains 1 NIDO domain.
    Contains 1 nidogen G2 beta-barrel domain.
    Contains 2 thyroglobulin type-1 domains.
  • Post-translational
    modifications

    Highly N- and O-glycosylated.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix > basement membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • NID 2 antibody
    • NID-2 antibody
    • Nid2 antibody
    • NID2_HUMAN antibody
    • Nidogen-2 antibody
    • Nidogen2 antibody
    • Osteonidogen antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for Nidogen 2/NID-2 using ab232883 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach tissue stained for Nidogen 2/NID-2 using ab232883 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Nidogen 2/NID-2 antibody (ab232883) at 2 µg/ml + Recombinant human Nidogen 2/NID-2 protein

    Predicted band size: 151 kDa

  • Anti-Nidogen 2/NID-2 antibody (ab232883) at 2 µg/ml + Human lung lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 151 kDa

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up