Overview

  • Product name

  • Description

    Rabbit polyclonal to NIF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human NIF1 aa 1194-1278.
    Sequence:

    VTNQEEAAYIQEITTADGQTVQHLVTSDNQVQYIISQDGVQHLLPQEYVV VPEGHHIQVQEGQITHIQYEQGAPFLQESQIQYVP


    Database link: Q9H4Z2

  • Positive control

    • ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221928 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    NIF1 enhances transcriptional activation by ligand-bound nuclear hormone receptors. However, it does this not by direct interaction with the receptor, but by direct interaction with the nuclear hormone receptor transcriptional coactivator NRC. This protein may function by altering local chromatin structure.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • 1810045J01Rik antibody
    • bA465L10.2 antibody
    • FZF-1 antibody
    • MGC86001 antibody
    • NIF-1 antibody
    • NIF-2 antibody
    • NIF2 antibody
    • NIF2, INCLUDED antibody
    • NRC interacting factor 1 antibody
    • NRC-interacting factor 1 antibody
    • NRC-INTERACTING FACTOR antibody
    • Nuclear Receptor Coactivator Interacting Factor 1 antibody
    • OTTHUMP00000031195 antibody
    • Zinc finger protein 335 antibody
    • Zinc finger/leucine zipper co transducer NIF1 antibody
    • zinc-finger/leucine-zipper co-transducer NIF1 antibody
    • ZNF335 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for NIF1 (green) using ab221928 (4 µg/ml) in ICC/IF.

References

ab221928 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221928.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up