Overview

  • Product name

    Anti-NIFK antibody [CL2237]
    See all NIFK primary antibodies
  • Description

    Mouse monoclonal [CL2237] to NIFK
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NIFK aa 181-261.
    Sequence:

    IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDS QGPTPVCTPTFLERRKSQVAELNDDDKDDEI


    Database link: Q9BYG3

  • Epitope

    Binds to an epitope located within the peptidesequence IDYDFPSLILQKTES as determined by overlapping synthetic peptides.
  • Positive control

    • IHC-P: Human skin, small intestine, pancreas, kidney, liver and fallopian tube tissues. WB: U-251 MG cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    CL2237
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa.

Target

  • Sequence similarities

    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications

    Sequentially phosphorylated on Thr-238, Thr-234 and Ser-230. Thr-234 is phosphorylated only when Thr-238 is phosphorylated. Likewise, phosphorylation at Ser-230 requires that Thr-234 and Thr-238 are phosphorylated. Phosphorylation enhances MKI67 binding.
  • Cellular localization

    Nucleus > nucleolus. Chromosome. Localizes to mitotic chromosomes in conjunction with MKI67.
  • Information by UniProt
  • Database links

  • Alternative names

    • hNIFK antibody
    • MK67I_HUMAN antibody
    • MKI67 FHA Domain Interacting Nucleolar Phosphoprotein antibody
    • MKI67 FHA domain-interacting nucleolar phosphoprotein antibody
    • mki67ip antibody
    • NOPP34 antibody
    • Nucleolar phosphoprotein Nopp34 antibody
    • Nucleolar protein interacting with the FHA domain of pKI 67 antibody
    • Nucleolar protein interacting with the FHA domain of pKI-67 antibody
    • pKi67 antibody
    see all

Images

  • Paraffin-embedded human fallopian tube tissue stained for NIFK using ab244216 at 1/2500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for NIFK using ab244216 at 1/2500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for NIFK using ab244216 at 1/2500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for NIFK using ab244216 at 1/2500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for NIFK using ab244216 at 1/2500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for NIFK using ab244216 at 1/2500 dilution in immunohistochemical analysis.

  • Anti-NIFK antibody [CL2237] (ab244216) at 1 µg/ml + U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 34 kDa

References

ab244216 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up