Anti-NIFK antibody [CL2240] - Nucleolar Marker (ab211871)

Overview

  • Product name

    Anti-NIFK antibody [CL2240] - Nucleolar Marker
    See all NIFK primary antibodies
  • Description

    Mouse monoclonal [CL2240] to NIFK - Nucleolar Marker
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NIFK aa 181-261.
    Sequence:

    IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDS QGPTPVCTPTFLERRKSQVAELNDDDKDDEI


    Database link: Q9BYG3

  • Epitope

    Binds to an epitope located within the peptide sequence KVSGTLDTPE (216-225aa) as determined by overlapping synthetic peptides.
  • Positive control

    • Human fallopian tube, Human cervix, Human endometrium, Human prostate, Human rectum and Human kidney tissues; HeLa, A431, MCF7, U2OS and U251 cell lines.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    CL2240
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab211871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Sequence similarities

    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications

    Sequentially phosphorylated on Thr-238, Thr-234 and Ser-230. Thr-234 is phosphorylated only when Thr-238 is phosphorylated. Likewise, phosphorylation at Ser-230 requires that Thr-234 and Thr-238 are phosphorylated. Phosphorylation enhances MKI67 binding.
  • Cellular localization

    Nucleus > nucleolus. Chromosome. Localizes to mitotic chromosomes in conjunction with MKI67.
  • Information by UniProt
  • Database links

  • Alternative names

    • hNIFK antibody
    • MK67I_HUMAN antibody
    • MKI67 FHA Domain Interacting Nucleolar Phosphoprotein antibody
    • MKI67 FHA domain-interacting nucleolar phosphoprotein antibody
    • mki67ip antibody
    • NOPP34 antibody
    • Nucleolar phosphoprotein Nopp34 antibody
    • Nucleolar protein interacting with the FHA domain of pKI 67 antibody
    • Nucleolar protein interacting with the FHA domain of pKI-67 antibody
    • pKi67 antibody
    see all

Images

  • Immunofluorescent analysis of formalin fixed, Triton X-100 permealized MCF7 cells labeling NIFK with ab211871 at 4 μg/ml dilution showing specific staining of nucleoli in green. Microtubules are visualized in red.

  • Immunofluorescent analysis of formalin fixed, Triton X-100 permealized U251 cells labeling NIFK with ab211871 at 4 μg/ml dilution showing specific staining of nucleoli in green. Microtubules are visualized in red.

  • Immunofluorescent analysis of formalin fixed, Triton X-100 permealized U2OS cells labeling NIFK with ab211871 at 4 μg/ml dilution showing specific staining of nucleoli in green. Microtubules are visualized in red.

  • Immunofluorescent analysis of formalin fixed, Triton X-100 permealized  A431 cells labeling NIFK with ab211871 at 4 μg/ml dilution showing specific staining of nucleoli in green. Microtubules are visualized in red.

  • Immunofluorescent analysis of formalin fixed, Triton X-100 permealized HeLa cells labeling NIFK with ab211871 at 4 μg/ml dilution showing specific staining of nucleoli in green. Microtubules are visualized in red.

  • Immunohistochemical analysis of formalin fixed, paraffin-embedded Human kidney tissue labeling NIFK with ab211871 at 1/200 dilution.

  • Immunohistochemical analysis of formalin fixed, paraffin-embedded Human rectum tissue labeling NIFK with ab211871 at 1/200 dilution.

  • Immunohistochemical analysis of formalin fixed, paraffin-embedded Human prostate tissue labeling NIFK with ab211871 at 1/200 dilution.

  • Immunohistochemical analysis of formalin fixed, paraffin-embedded Human endometrium tissue labeling NIFK with ab211871 at 1/200 dilution.

  • Immunohistochemical analysis of formalin fixed, paraffin-embedded Human cervix tissue labeling NIFK with ab211871 at 1/200 dilution.

  • Immunohistochemical analysis of formalin fixed, paraffin-embedded Human fallopian tube tissue labeling NIFK with ab211871 at 1/200 dilution.

References

ab211871 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (Lung cancer cell line: A549 & PC13)
Gel Running Conditions
Reduced Denaturing (10% gel)
Loading amount
50 µg
Treatment
Overexpressed RFP or NIFK
Specification
Lung cancer cell line: A549 & PC13
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Mar 27 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up