Anti-Ninjurin 1 antibody (ab213695)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Ninjurin 1 antibody
See all Ninjurin 1 primary antibodies -
Description
Rabbit polyclonal to Ninjurin 1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Synthetic peptide within Human Ninjurin 1 aa 30-70 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:GWRHGPINVNHYASKKSAAESMLDIALLMANASQLKAVVEQ
Database link: Q92982 -
Positive control
- Human meningioma and lung carcinoma tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab213695 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. |
Target
-
Function
Homophilic cell adhesion molecule that promotes axonal growth. May play a role in nerve regeneration and in the formation and function of other tissues. Cell adhesion requires divalent cations. -
Tissue specificity
Widely expressed in both adult and embryonic tissues, primarily those of epithelial origin. -
Sequence similarities
Belongs to the ninjurin family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 4814 Human
- Entrez Gene: 18081 Mouse
- Entrez Gene: 25338 Rat
- Omim: 602062 Human
- SwissProt: Q92982 Human
- SwissProt: O70131 Mouse
- SwissProt: P70617 Rat
- Unigene: 494457 Human
see all -
Alternative names
- Nerve injury induced protein 1 antibody
- Nerve injury-induced protein 1 antibody
- NIN1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ninjurin 1 antibody (ab213695)Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lung carcinoma tissue labeling Ninjurin 1 with ab213695 at 1/500 dilution, followed by conjugation to a secondary antibody and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ninjurin 1 antibody (ab213695)Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human meningioma tissue labeling Ninjurin 1 with ab213695 at 1/200 dilution, followed by conjugation to a secondary antibody and DAB staining.
Protocols
Datasheets and documents
References
ab213695 has not yet been referenced specifically in any publications.
