Anti-Ninjurin 1 antibody (ab213695)
Key features and details
- Rabbit polyclonal to Ninjurin 1
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Ninjurin 1 antibody -
Description
Rabbit polyclonal to Ninjurin 1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Synthetic peptide within Human Ninjurin 1 aa 30-70 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:GWRHGPINVNHYASKKSAAESMLDIALLMANASQLKAVVEQ
Database link: Q92982 -
Positive control
- Human meningioma and lung carcinoma tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab213695 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. |
Target
-
Function
Homophilic cell adhesion molecule that promotes axonal growth. May play a role in nerve regeneration and in the formation and function of other tissues. Cell adhesion requires divalent cations. -
Tissue specificity
Widely expressed in both adult and embryonic tissues, primarily those of epithelial origin. -
Sequence similarities
Belongs to the ninjurin family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 4814 Human
- Entrez Gene: 18081 Mouse
- Entrez Gene: 25338 Rat
- Omim: 602062 Human
- SwissProt: Q92982 Human
- SwissProt: O70131 Mouse
- SwissProt: P70617 Rat
- Unigene: 494457 Human
see all -
Alternative names
- Nerve injury induced protein 1 antibody
- Nerve injury-induced protein 1 antibody
- NIN1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ninjurin 1 antibody (ab213695)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lung carcinoma tissue labeling Ninjurin 1 with ab213695 at 1/500 dilution, followed by conjugation to a secondary antibody and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Ninjurin 1 antibody (ab213695)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human meningioma tissue labeling Ninjurin 1 with ab213695 at 1/200 dilution, followed by conjugation to a secondary antibody and DAB staining.
Datasheets and documents
References (0)
ab213695 has not yet been referenced specifically in any publications.