Overview

  • Product name

  • Description

    Rabbit polyclonal to NINL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NINL aa 1-190.
    Sequence:

    MDEEENHYVSQLREVYSSCDTTGTGFLDRQELTQLCLKLHLEQQLPVLLQ TLLGNDHFARVNFEEFKEGFVAVLSSNAGVRPSDEDSSSLESAASSAIPP KYVNGSKWYGRRSRPELCDAATEARRVPEQQTQASLKSHLWRSASLESVE SPKSDEEAESTKEAQNELFEAQGQLQTWDSEDFGSPQKSC


    Database link: Q9Y2I6

  • Positive control

    • IHC-P: Human brain and adrenal gland tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab234784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in the microtubule organization in interphase cells. Overexpression induces the fragmentation of the Golgi, and causes lysosomes to disperse toward the cell periphery; it also interferes with mitotic spindle assembly. May play a role in ovarian carcinogenesis.
  • Tissue specificity

    Expressed in KYSE150 esophageal carcinoma, HeLa cervical carcinoma and U2OS osteosarcoma cells. Expression is regulated in a cell cycle-dependent manner and peaks during G2/M phase (at protein level). Expressed in fetal heart, skeletal muscle, liver, lung and cochlea, and in adult brain, testis, kidney and retina.
  • Sequence similarities

    Contains 4 EF-hand domains.
  • Domain

    The KEN and D (destructive) boxes are required for the cell cycle-controlled NINL degradation by the APC/C pathway.
  • Post-translational
    modifications

    Phosphorylated by PLK1 which disrupts its centrosome association and interaction with gamma-tubulin.
    Ubiquitinated by the APC/C complex leading to its degradation.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome. Cytoplasm. In interphase cells, NINL is transported to the centrosomes by the dynein-dynactin motor complex. During centrosome maturation, PLK1 directly phosphorylates NINL resulting in its release into the cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4930519N13Rik antibody
    • dJ691N24.1 antibody
    • Gm1004, antibody
    • Gm1634 antibody
    • mKIAA0980 antibody
    • Ninein like antibody
    • Ninein-like protein antibody
    • NINL antibody
    • NINL_HUMAN antibody
    • Nlp antibody
    • RGD1306152 antibody
    • RP23-193L22.3 antibody
    • RP4-691N24.1 antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for NINL using ab234784 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for NINL using ab234784 at 1/100 dilution in immunohistochemical analysis.

References

ab234784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up