Overview

  • Product name

  • Description

    Rabbit polyclonal to NIP7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Pig, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human NIP7 aa 1-180.
    Sequence:

    MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEK IMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIK PGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKST QDCRKVDPMAIVVFHQADIGEYVRHEETLT


    Database link: Q9Y221

  • Positive control

    • IHC-P: Human kidney tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab238736 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • Paraffin-embedded human kidney tissue stained for NIP7 using ab238736 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for NIP7 (green) using ab238736 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L).

References

ab238736 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238736.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up