Overview

  • Product name

  • Description

    Rabbit polyclonal to NIPA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NIPA aa 5-108.
    Sequence:

    CEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEGIAPEEGGVDAKDTSA TSQSVNGSPQAEQPSLESTSKEAFFSRVETFSSLKWAGKPFELSPLVCAK YGWV


    Database link: Q86WB0

  • Positive control

    • WB: U-251 MG sp cell lysate. IHC-P: Human gall bladder tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 55 kDa.

Target

  • Function

    Essential component of an SCF-type E3 ligase complex, SCF(NIPA), a complex that controls mitotic entry by mediating ubiquitination and subsequent degradation of cyclin B1 (CCNB1). Its cell-cycle-dependent phosphorylation regulates the assembly of the SCF(NIPA) complex, restricting CCNB1 ubiquitination activity to interphase. Its inactivation results in nuclear accumulation of CCNB1 in interphase and premature mitotic entry. May have an antiapoptotic role in NPM-ALK-mediated signaling events.
  • Tissue specificity

    Widely expressed. Highly expressed in heart, skeletal muscle and testis. Expressed in brain, placenta, lung, kidney, liver, pancreas, spleen, thymus, prostate, ovary small intestine and colon. Weakly or not expressed in leukocytes.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 C3HC-type zinc finger.
  • Developmental stage

    Weakly expressed in G0/G1 phases, abundant during S and G2/M phases, and strongly decreases thereafter.
  • Domain

    The F-box-like region is required for the interaction with SKP1.
  • Post-translational
    modifications

    Phosphorylated. Phosphorylated on Ser residues at G2/M phase, but not during S and G0 phases. May also be weakly phosphorylated on Tyr residues. Ser-354 phosphorylation, a major site during the course of cell-cycle-dedendent phosphorylation, results in its dissociation from the SCF(NIPA) complex, thereby preventing CCNB1 degradation leading to mitotic entry.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • hNIPA antibody
    • NIPA_HUMAN antibody
    • Nuclear interacting partner of ALK antibody
    • Nuclear interacting partner of anaplastic lymphoma kinase antibody
    • Nuclear-interacting partner of ALK antibody
    • Nuclear-interacting partner of anaplastic lymphoma kinase antibody
    • zc3hc1 antibody
    • Zinc finger C3HC type containing 1 antibody
    • Zinc finger C3HC-type protein 1 antibody
    see all

Images

  • All lanes : Anti-NIPA antibody (ab224108) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate

    Predicted band size: 55 kDa

  • Paraffin-embedded human gall bladder tissue stained for NIPA with ab224108 (1/20) in immunohistochemical analysis.

References

ab224108 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up