Overview

  • Product name

  • Description

    Rabbit polyclonal to NIPBL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Zebrafish
  • Immunogen

    Recombinant fragment corresponding to Human NIPBL aa 1734-1830.
    Sequence:

    TPSQFSTLKMNSDTVDYDDACLIVRYLASMRPFAQSFDIYLTQILRVLGE NAIAVRTKAMKCLSEVVAVDPSILARLDMQRGVHGRLMDNSTSVREA


    Database link: Q6KC79

  • Positive control

    • Human SiHa cell line
  • General notes

     This product was previously labelled as IDN3

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Probably plays a structural role in chromatin. Involved in sister chromatid cohesion, possibly by interacting with the cohesin complex.
  • Tissue specificity

    Widely expressed. Highly expressed in heart, skeletal muscle, fetal and adult liver, fetal and adult kidney. Expressed at intermediates level in thymus, placenta, peripheral leukocyte and small intestine. Weakly or not expressed in brain, colon, spleen and lung.
  • Involvement in disease

    Cornelia de Lange syndrome 1
  • Sequence similarities

    Belongs to the SCC2/Nipped-B family.
    Contains 5 HEAT repeats.
  • Developmental stage

    In embryos, it is expressed in developing limbs and later in cartilage primordia of the ulna and of various hand bones. Sites of craniofacial expression include the cartilage primordium of the basioccipital and basisphenoid skull bones and elsewhere in the head and face, including a region encompassing the mesenchyme adjacent to the cochlear canal. Also expressed in the spinal column, notochord and surface ectoderm sclerotome and what seem to be migrating myoblasts. Expressed in the developing heart in the atrial and ventricular myocardium and in the ventricular tubeculae but absent in the endocardial cushions. Also expressed in the developing esophagus, trachea and midgut loops, in the bronchi of the lung and in the tubules of the metanephros. Expression in organs and tissues not typically affected in CDL (e.g. the developing trachea, bronchi, esophagus, heart and kidney) may reflect a bias towards underreporting of more subtle aspects of the phenotype or problems that typically present later in life. Expressed in the mesenchyme surrounding the cochlear canal possibly reflecting the hearing impairment commonly found. Weakly or not expressed in embryonic brain.
  • Domain

    Contains one Pro-Xaa-Val-Xaa-Leu (PxVxL) motif, which is required for interaction with chromoshadow domains. This motif requires additional residues -7, -6, +4 and +5 of the central Val which contact the chromoshadow domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Form

    There are 3 isoforms produced by alternative splicing. Isoform 1 also known as: A; IDN3-A. Isoform 2 also known as: B; IDN3-B.
  • Alternative names

    • CDLS antibody
    • Colon tumor susceptibility 2 antibody
    • Delangin antibody
    • DKFZp434L1319 antibody
    • FLJ11203 antibody
    • FLJ12597 antibody
    • FLJ13354 antibody
    • FLJ13648 antibody
    • FLJ44854 antibody
    • IDN 3 antibody
    • IDN 3 protein antibody
    • IDN 3 protein isoform A antibody
    • IDN 3 protein isoform B antibody
    • IDN 3B antibody
    • IDN3 B antibody
    • IDN3 protein antibody
    • IDN3 protein isoform A antibody
    • IDN3 protein isoform B antibody
    • IDN3B antibody
    • Mis 4 antibody
    • Mis4 antibody
    • Nipbl antibody
    • NIPBL_HUMAN antibody
    • Nipped B homolog (Drosophila) antibody
    • Nipped B homolog antibody
    • Nipped B like antibody
    • Nipped B like protein antibody
    • Nipped-B-like protein antibody
    • Scc 2 antibody
    • SCC 2 homolog antibody
    • Scc2 antibody
    • SCC2 homolog antibody
    • Sister chromatid cohesion protein Mis4 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SiHa cells labeling NIPBL with ab220952 at 4 µg/ml (green).

References

ab220952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up