Overview

  • Product name

  • Description

    Rabbit polyclonal to NIR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NIR2 aa 589-651.
    Sequence:

    SRRGSMNNELLSPEFGPVRDPLADGVEGLGRGSPEPSALPPQRIPSDMAS PEPEGSQNSLQAA


    Database link: O00562

  • Positive control

    • HaCaT cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Regulates RHOA activity, and plays a role in cytoskeleton remodeling. Necessary for normal completion of cytokinesis. Plays a role in maintaining normal diacylglycerol levels in the Golgi apparatus. Binds phosphatidyl inositol phosphates (in vitro). May catalyze the transfer of phosphatidylinositol and phosphatidylcholine between membranes (By similarity). Necessary for maintaining the normal structure of the endoplasmic reticulum and the Golgi apparatus. Required for protein export from the endoplasmic reticulum and the Golgi. Binds calcium ions.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the PtdIns transfer protein family. PI transfer class IIA subfamily.
    Contains 1 DDHD domain.
  • Post-translational
    modifications

    Phosphorylated on multiple sites by CDK1 at the onset of mitosis. Phosphorylation facilitates dissociation from the Golgi complex and is required for interaction with PLK1.
    Phosphorylated on threonine residues upon treatment with oleic acid.
    Phosphorylated on tyrosine residues by PTK2B.
  • Cellular localization

    Cytoplasm. Golgi apparatus > Golgi stack membrane. Endoplasmic reticulum membrane. Lipid droplet. Cleavage furrow. Midbody. Peripheral membrane protein associated with Golgi stacks in interphase cells. A minor proportion is associated with the endoplasmic reticulum. Associated with lipid droplets. Dissociates from the Golgi early on in mitosis and localizes to the cleavage furrow and midbody during cytokinesis.
  • Information by UniProt
  • Database links

  • Alternative names

    • DRES9 antibody
    • Drosophila retinal degeneration B antibody
    • Drosophila retinal degeneration B homolog antibody
    • FLJ44997 antibody
    • membrane-associated 1 antibody
    • Membrane-associated phosphatidylinositol transfer protein 1 antibody
    • NIR 2 antibody
    • NIR-2 antibody
    • NIR2 antibody
    • OTTHUMP00000236414 antibody
    • OTTHUMP00000236415 antibody
    • Phosphatidylinositol transfer protein antibody
    • phosphatidylinositol transfer protein membrane associated antibody
    • PITM1_HUMAN antibody
    • PITPnm 1 antibody
    • PITPNM antibody
    • Pitpnm1 antibody
    • PYK2 N terminal domain interacting receptor 2 antibody
    • Pyk2 N-terminal domain-interacting receptor 2 antibody
    • RD 9 antibody
    • RD9 antibody
    • RDGB antibody
    • RDGB1 antibody
    • RDGBA1 antibody
    • retinal degeneration B alpha 1 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HaCaT cells labeling NIR2 with ab221381 at 4 μg/ml (green).

References

ab221381 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221381.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up