Overview

  • Product name

  • Description

    Rabbit polyclonal to NK-2R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat NK-2R aa 1-200. (expressed in E.coli)
    Sequence:

    MGTRAIVSDANILSGLESNATGVTAFSMPGWQLALWATAYLALVLVAVTG NATVIWIILAHERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWY FGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKA IIAGIWLVALALASPQCFYSTITVDEGATKCVVAWPNDNGGKMLLLYHLV


    Database link: P16610

  • Positive control

    • WB: Recombinant rat NK-2R protein; Mouse spleen lysate. IHC-P: Rat kidney and testis tissue.
  • General notes

    Previously labelled as Neurokinin A Receptor. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Predicted molecular weight: 44 kDa.
IHC-P Use a concentration of 20 µg/ml.

Target

  • Function

    This is a receptor for the tachykinin neuropeptide substance K (neurokinin A). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance K > neuromedin-K > substance P.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Neurokinin 2 receptor antibody
    • Neurokinin A receptor antibody
    • NK 2 receptor antibody
    • NK 2R antibody
    • NK-2 receptor antibody
    • NK-2R antibody
    • NK2 receptor antibody
    • NK2R antibody
    • NK2R_HUMAN antibody
    • NKNAR antibody
    • Seven transmembrane helix receptor antibody
    • SKR antibody
    • Substance K receptor antibody
    • Substance-K receptor antibody
    • TAC 2R antibody
    • TAC R2 antibody
    • TAC2R antibody
    • Tachykinin receptor 2 (substance K receptor; neurokinin 2 receptor) antibody
    • Tachykinin receptor 2 antibody
    • TACR 2 antibody
    • TACR2 antibody
    see all

Images

  • Anti-NK-2R antibody (ab231716) at 2 µg/ml + Mouse spleen lysate.

    Developed using the ECL technique.

    Predicted band size: 44 kDa

  • Anti-NK-2R antibody (ab231716) at 2 µg/ml + Recombinant rat NK-2R protein.

    Developed using the ECL technique.

    Predicted band size: 44 kDa

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for NK-2R using ab231716 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for NK-2R using ab231716 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab231716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up