Overview

  • Product name

  • Description

    Rabbit polyclonal to NK-2R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human NK-2R aa 92-290. Expressed in E.coli. N-terminal tag.
    Sequence:

    VYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQP RLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGG KTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLRH LQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYL


    Database link: P21452

  • Positive control

    • WB: Human lung lysate; HeLa cell lysate; Pig small intestine and heart lysate; Recombinant human NK-2R protein. IHC-P: Human pancreatic cancer, breast cancer and stomach tissue. ICC/IF: HeLa cells.
  • General notes

    Previously labelled as Neurokinin A Receptor. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233295 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    This is a receptor for the tachykinin neuropeptide substance K (neurokinin A). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance K > neuromedin-K > substance P.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Neurokinin 2 receptor antibody
    • Neurokinin A receptor antibody
    • NK 2 receptor antibody
    • NK 2R antibody
    • NK-2 receptor antibody
    • NK-2R antibody
    • NK2 receptor antibody
    • NK2R antibody
    • NK2R_HUMAN antibody
    • NKNAR antibody
    • Seven transmembrane helix receptor antibody
    • SKR antibody
    • Substance K receptor antibody
    • Substance-K receptor antibody
    • TAC 2R antibody
    • TAC R2 antibody
    • TAC2R antibody
    • Tachykinin receptor 2 (substance K receptor; neurokinin 2 receptor) antibody
    • Tachykinin receptor 2 antibody
    • TACR 2 antibody
    • TACR2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for NK-2R using ab233295 at 10 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for NK-2R using ab233295 (green) at 10 µg/mL in ICC/IF. FITC-labeled secondary antibody.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for NK-2R using ab233295 at 10 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human pancreatic cancer tissue stained for NK-2R using ab233295 at 10 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Anti-NK-2R antibody (ab233295) at 1 µg/ml + Pig heart lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-NK-2R antibody (ab233295) at 1 µg/ml + Pig small intestine lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-NK-2R antibody (ab233295) at 1 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-NK-2R antibody (ab233295) at 1 µg/ml + Human lung lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-NK-2R antibody (ab233295) at 2 µg/ml + Recombinant human NK-2R protein

References

ab233295 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233295.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up