Overview

  • Product name

  • Description

    Rabbit polyclonal to NKB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NKB aa 20-90.
    Sequence:

    GAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQAST DPKESTSPEKRDMHDFFVGLM


    Database link: Q9UHF0

  • Positive control

    • WB: NKB (with C-terminal myc-DDK tag) everexpressed in HEK-293T, cell lysate. IHC-P: Human cerebellum tissue. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 13 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.
  • Sequence similarities

    Belongs to the tachykinin family.
  • Developmental stage

    In pregnancy, the expression of NKB is confined to the outer syncytiotrophoblast of the placenta, significant concentrations of NKB can be detected in plasma as early as week 9, and plasma concentrations of NKB are grossly elevated in pregnancy-induced hypertension and pre-eclampsia.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Gamma tachykinin 3 antibody
    • Neurokinin B antibody
    • Neurokinin B like protein antibody
    • Neurokinin B protein antibody
    • Neurokinin beta antibody
    • Neurokinin-B antibody
    • NeurokininB antibody
    • Neuromedin K antibody
    • Neuromedin-K antibody
    • NeuromedinK antibody
    • NKB antibody
    • NKNB antibody
    • Preprotachykinin B antibody
    • PreprotachykininB antibody
    • PRO 1155 antibody
    • PRO1155 antibody
    • TAC 3 antibody
    • TAC3 antibody
    • Tachykinin 3 antibody
    • Tachykinin3 antibody
    • TKNK_HUMAN antibody
    • ZNEUROK 1 antibody
    • ZNEUROK1 antibody
    see all

Images

  • All lanes : Anti-NKB antibody (ab244479) at 0.4 µg/ml

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : NKB (with C-terminal myc-DDK tag) everexpressed in HEK-293T, cell lysate

    Predicted band size: 13 kDa

  • Paraffin-embedded human cerebellum tissue stained for NKB using ab244479 at 1/200 dilution in immunohistochemical analysis.
  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for NKB (green) using ab244479 at 4 μg/ml in ICC/IF.

References

ab244479 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up