Overview

  • Product name

    Anti-NKF3 kinase family member/PEAK1 antibody
  • Description

    Rabbit polyclonal to NKF3 kinase family member/PEAK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NKF3 kinase family member/PEAK1 aa 81-166.
    Sequence:

    DGQSICGELSIQEHCENKPVIIGWNRNRAALSQKPLNNNNEDDEGISHVP KPYGNNDSAKKMSDNNNGLTEVLKEIAGLDTAPQIR

  • Positive control

    • Human stomach tissue.
  • General notes

     This product was previously labelled as NKF3 kinase family member

     

Properties

Applications

Our Abpromise guarantee covers the use of ab121865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

Target

  • Function

    Tyrosine kinase that may play a role in cell spreading and migration on fibronectin. May directly or indirectly affect phosphorylation levels of cytoskeleton-associated proteins MAPK1/ERK and PXN.
  • Sequence similarities

    Belongs to the protein kinase superfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine in a CSK-dependent manner in response to adhesion to fibronectin and to EGF stimulation. Autophosphorylated in vitro.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell junction > focal adhesion. Colocalizes with F-actin in serum-rich medium. Actin colocalization is reduced during serum starvation.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ21140 antibody
    • FLJ34483 antibody
    • KIAA2002 antibody
    • NKF3 kinase family member antibody
    • PEAK1 antibody
    • PEAK1_HUMAN antibody
    • pseudopodium enriched atypical kinase antibody
    • Pseudopodium-enriched atypical kinase 1 antibody
    • SGK269 antibody
    • Sugen kinase 269 antibody
    • Tyrosine-protein kinase SgK269 antibody
    see all

Images

  • Immunofluorescent staining of Human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm. Recommended concentration of ab121865 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab121865, at a 1/10 dilution, staining NKF3 kinase family member/PEAK1 in glandular cells of paraffin-embedded Human stomach tissue by immunohistochemistry.

References

ab121865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up