Overview

  • Product name

  • Description

    Rabbit polyclonal to NKG2D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Rat NKG2D aa 130-170 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    NSSLLKIYSKEEQDFLKLVKSYHWMGLVQSPANGSWQWEDG


    Database link: O70215

  • Positive control

    • Human nasopharyngeal carcinoma tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203353 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 24 kDa.
Flow Cyt 1/20 - 1/100.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(or 1/50 -1/200 using a fluorescent secondary antibody).

Target

  • Function

    Receptor for MICA, MICB, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4. Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. Involved in the immune surveillance exerted by T- and B-lymphocytes.
  • Tissue specificity

    Natural killer cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Also detected in gamma-delta cells and CD8+ alpha-beta T-cells. Expressed in interferon-producing killer dendritic cells (IKDCs).
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD314 antibody
    • CD314 antigen antibody
    • D12S2489E antibody
    • Killer cell lectin like receptor subfamily K member 1 antibody
    • Killer cell lectin-like receptor subfamily K member 1 antibody
    • KLR antibody
    • KLRC4 KLRK1 readthrough antibody
    • KLRK1 antibody
    • NK cell receptor D antibody
    • NK lectin-like receptor antibody
    • NKG2 D activating NK receptor antibody
    • NKG2 D type II integral membrane protein antibody
    • NKG2-D antibody
    • NKG2-D type II integral membrane protein antibody
    • NKG2-D-activating NK receptor antibody
    • Nkg2d antibody
    • NKG2D_HUMAN antibody
    • NKLLR antibody
    • NKR P2 antibody
    • Nkrp2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded Human nasopharyngeal carcinoma tissue labeling NKG2D with ab203353 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Thymus cells probed with ab203353 (green) at 1:100 dilution for 30 minutes compared to control cells (blue) and isotype control (orange)

  • ab203353 staining NKG2D in mouse lymph node tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections). Tissue was fixed with paraformaldehyde and blocked with 20% serum for 20 minutes at 37°C; antigen retrieval was by heat mediation in a citrate buffer for 15 minutes. Samples were incubated with primary antibody (1/400 in blocking buffer) overnight at 4°C, followed by a conjugated secondary and DAB staining.

References

This product has been referenced in:

  • Mackiewicz Z  et al. Sjögren's Syndrome: Concerted Triggering of Sicca Conditions. J Immunol Res 2019:2075803 (2019). Read more (PubMed: 30723748) »
  • Mo Z  et al. Ultrasound-guided radiofrequency ablation enhances natural killer-mediated antitumor immunity against liver cancer. Oncol Lett 15:7014-7020 (2018). Read more (PubMed: 29725428) »
See all 3 Publications for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (mammary carcinoma (cell type: 4T1-Luc2))
Permeabilization
No
Specification
mammary carcinoma (cell type: 4T1-Luc2)
Fixative
Acetone

Henrik Rauße

Verified customer

Submitted Jan 23 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up