Overview

  • Product name

  • Description

    Rabbit polyclonal to NKIRAS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human NKIRAS1 aa 1-192.
    Sequence:

    MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETD RGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELL KKEIDKFKDKKEVAIVVLGNKIDLSEQRQVDAEVAQQWAKSEKVRLWEVT VTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN


    Database link: Q9NYS0

  • Positive control

    • WB: HepG2 whole cell lysate. IHC-P: Human pancreatic and kidney tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235310 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 22 kDa.

Target

  • Function

    Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Ras family. KappaB-Ras subfamily.
  • Domain

    In contrast to other members of the Ras family, the members of the KappaB-Ras subfamily do not contain the conserved Gly and Gln residues in positions 13 and 65, which are replaced by Leu residues, and are therefore similar to the constitutively active forms of oncogenic forms of Ras. This suggests that members of this family are clearly different from other small GTPases proteins.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2400004O09Rik antibody
    • I kappa B interacting Ras like protein 1 antibody
    • I-kappa-B-interacting Ras-like protein 1 antibody
    • Kappa B Ras 1 antibody
    • Kappa B Ras protein 1 antibody
    • Kappa B-Ras protein 1 antibody
    • KappaB Ras1 antibody
    • KappaB-Ras1 antibody
    • KBRAS 1 antibody
    • KBRAS1 antibody
    • KBRS1_HUMAN antibody
    • NF kappa B inhibitor interacting Ras like protein 1 antibody
    • NF-kappa-B inhibitor-interacting Ras-like protein 1 antibody
    • NFKB inhibitor interacting Ras like 1 antibody
    • NFKB inhibitor interacting Ras like protein 1 antibody
    • NKIRAS 1 antibody
    • nkiras1 antibody
    see all

Images

  • Anti-NKIRAS1 antibody (ab235310) at 1/500 dilution + HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 22 kDa

  • Paraffin-embedded human pancreatic tissue stained for NKIRAS1 using ab235310 at 1/100 dilution in immunohistochemical analysis.

          

  • Paraffin-embedded human kidney tissue stained for NKIRAS1 using ab235310 at 1/100 dilution in immunohistochemical analysis.

References

ab235310 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235310.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up