Overview

  • Product name

  • Description

    Rabbit polyclonal to Nkx2.2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Nkx2.2 aa 2-119.
    Sequence:

    SLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQG ALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSS KSPEPSADESPDNDKETP


    Database link: O95096

  • Positive control

    • WB: U-138 MG cell lysate; Nkx2.2 overexpression HEK-293T cell lysate. IHC-P: Human pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab244270 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 30 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance.
  • Sequence similarities

    Belongs to the NK-2 homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Domain

    The homeodomain is essential for interaction with OLIG2.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Homeobox protein NK 2 homolog B antibody
    • Homeobox protein NK-2 homolog B antibody
    • Homeobox protein Nkx 2.2 antibody
    • Homeobox protein Nkx-2.2 antibody
    • NK 2 homolog B antibody
    • NK2 homeobox 2 antibody
    • NK2 transcription factor like protein B antibody
    • NK2 transcription factor related locus 2 antibody
    • NKX2 2 antibody
    • NKX2-2 antibody
    • NKX22 antibody
    • NKX22_HUMAN antibody
    • Nkx2b antibody
    • tinman antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for Nkx2.2 using ab244270 at 1/50 dilution in immunohistochemical analysis.

  • Anti-Nkx2.2 antibody (ab244270) at 0.4 µg/ml + U-138 MG (human glioblastoma cell line) cell lysate

    Predicted band size: 30 kDa

  • All lanes : Anti-Nkx2.2 antibody (ab244270) at 0.4 µg/ml

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : Nkx2.2 overexpression HEK-293T cell lysate

    Predicted band size: 30 kDa

References

ab244270 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244270.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up