Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free (ab212686)
Key features and details
- Mouse monoclonal [NX2/294] to Nkx2.2 - BSA and Azide free
- Suitable for: IHC-P
- Reacts with: Mouse, Rat, Chicken, Human
- Isotype: IgG2b
Overview
-
Product name
Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free
See all Nkx2.2 primary antibodies -
Description
Mouse monoclonal [NX2/294] to Nkx2.2 - BSA and Azide free -
Host species
Mouse -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Chicken, Human -
Immunogen
Recombinant full length protein corresponding to Human Nkx2.2 aa 1-273.
Sequence:MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ GALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSS SKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQ RYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSP RRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQ YSSASTPQYPTAHPLVQAQQWTW
Database link: O95096 -
Positive control
- Pancreas or Ewing's sarcoma tissue
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: 100% PBS -
Carrier free
Yes -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
Purified from bioreactor concentrate. -
Clonality
Monoclonal -
Clone number
NX2/294 -
Isotype
IgG2b -
Light chain type
kappa -
Research areas
Associated products
-
Alternative Versions
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab212686 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. for 30 minutes at room temperature. |
Target
-
Function
May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. -
Sequence similarities
Belongs to the NK-2 homeobox family.
Contains 1 homeobox DNA-binding domain. -
Domain
The homeodomain is essential for interaction with OLIG2. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 428549 Chicken
- Entrez Gene: 4821 Human
- Entrez Gene: 18088 Mouse
- Entrez Gene: 366214 Rat
- Omim: 604612 Human
- SwissProt: O95096 Human
- SwissProt: P42586 Mouse
- Unigene: 516922 Human
see all -
Alternative names
- Homeobox protein NK 2 homolog B antibody
- Homeobox protein NK-2 homolog B antibody
- Homeobox protein Nkx 2.2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free (ab212686)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human Ewing's Sarcoma tissue section labeling Nkx2.2 with ab212686 at 1 µg/mL.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free (ab212686)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human pancreas tissue section labeling Nkx2.2 with ab212686 at 1 µg/mL.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free (ab212686)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat pancreas tissue section labeling Nkx2.2 with ab212686 at 1 µg/mL.
Datasheets and documents
References (0)
ab212686 has not yet been referenced specifically in any publications.