For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    nkx22-antibody-nx2294-bsa-and-azide-free-ab212686.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurology process Growth and Development Axonal Guidance Proteins
Share by email

Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free (ab212686)

  • Datasheet
Reviews (1) Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free (ab212686)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free (ab212686)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free (ab212686)

Key features and details

  • Mouse monoclonal [NX2/294] to Nkx2.2 - BSA and Azide free
  • Suitable for: IHC-P
  • Reacts with: Mouse, Rat, Chicken, Human
  • Isotype: IgG2b

You may also be interested in

Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free
    See all Nkx2.2 primary antibodies
  • Description

    Mouse monoclonal [NX2/294] to Nkx2.2 - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Chicken, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Nkx2.2 aa 1-273.
    Sequence:

    MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ GALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSS SKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQ RYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSP RRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQ YSSASTPQYPTAHPLVQAQQWTW


    Database link: O95096
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Pancreas or Ewing's sarcoma tissue
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Carrier free

    Yes
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Purified from bioreactor concentrate.
  • Clonality

    Monoclonal
  • Clone number

    NX2/294
  • Isotype

    IgG2b
  • Light chain type

    kappa
  • Research areas

    • Neuroscience
    • Neurology process
    • Growth and Development
    • Axonal Guidance Proteins
    • Neuroscience
    • Neurology process
    • Neurogenesis
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Developmental Families
    • Other
    • Stem Cells
    • Lineage Markers
    • Ectoderm
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Transcription Factors
    • Developmental Biology
    • Organogenesis
    • Gut development
    • Pancreas development

Associated products

  • Alternative Versions

    • Anti-Nkx2.2 antibody [NX2/294] (ab187375)
  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Conjugation kits

    • PE / R-Phycoerythrin Conjugation Kit - Lightning-Link® (ab102918)
    • APC Conjugation Kit - Lightning-Link® (ab201807)
  • Isotype control

    • Mouse IgG2b, kappa monoclonal [7E10G10] - Isotype Control (ab170192)

Applications

Our Abpromise guarantee covers the use of ab212686 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

for 30 minutes at room temperature.

Target

  • Function

    May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance.
  • Sequence similarities

    Belongs to the NK-2 homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Domain

    The homeodomain is essential for interaction with OLIG2.
  • Cellular localization

    Nucleus.
  • Target information above from: UniProt accession O95096 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 428549 Chicken
    • Entrez Gene: 4821 Human
    • Entrez Gene: 18088 Mouse
    • Entrez Gene: 366214 Rat
    • Omim: 604612 Human
    • SwissProt: O95096 Human
    • SwissProt: P42586 Mouse
    • Unigene: 516922 Human
    • Unigene: 330639 Mouse
    • Unigene: 32651 Rat
    see all
  • Alternative names

    • Homeobox protein NK 2 homolog B antibody
    • Homeobox protein NK-2 homolog B antibody
    • Homeobox protein Nkx 2.2 antibody
    • Homeobox protein Nkx-2.2 antibody
    • NK 2 homolog B antibody
    • NK2 homeobox 2 antibody
    • NK2 transcription factor like protein B antibody
    • NK2 transcription factor related locus 2 antibody
    • NKX2 2 antibody
    • NKX2-2 antibody
    • NKX22 antibody
    • NKX22_HUMAN antibody
    • Nkx2b antibody
    • tinman antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free (ab212686)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free (ab212686)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human Ewing's Sarcoma tissue section labeling Nkx2.2 with ab212686 at 1 µg/mL.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free (ab212686)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free (ab212686)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human pancreas tissue section labeling Nkx2.2 with ab212686 at 1 µg/mL.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free (ab212686)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free (ab212686)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat pancreas tissue section labeling Nkx2.2 with ab212686 at 1 µg/mL.

Protocols

  • Immunohistochemistry protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab212686? Please let us know so that we can cite the reference in this datasheet.

    ab212686 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Mass Cytometry abreview for Anti-Nkx2.2 antibody [NX2/294] - BSA and Azide free

    Excellent
    Abreviews
    Abreviews
    Application
    Mass Cytometry
    Sample
    Mouse Cell (Lung)
    Specification
    Lung
    Read More

    Irit Milman Krentsis

    Verified customer

    Submitted Nov 14 2017

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.