Overview

  • Product name

  • Description

    Rabbit polyclonal to Nkx2.5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Mouse Nkx2.5 aa 80-130 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    KCSPAFPAAPTFYPGAYGDPDPAKDPRADKKELCALQKAVELDKAETDGA E


    Database link: P42582

  • Positive control

    • IHC-P: Rat heart tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Implicated in commitment to and/or differentiation of the myocardial lineage. Acts as a transcriptional activator of ANF in cooperation with GATA4 (By similarity). It is transcriptionally controlled by PBX1 and acts as a transcriptional repressor of CDKN2B (By similarity). It is required for spleen development.
  • Tissue specificity

    Expressed only in the heart.
  • Involvement in disease

    Atrial septal defect 7, with or without atrioventricular conduction defects
    Tetralogy of Fallot
    Conotruncal heart malformations
    Hypothyroidism, congenital, non-goitrous, 5
    Ventricular septal defect 3
    Hypoplastic left heart syndrome 2
    Asplenia, isolated congenital
  • Sequence similarities

    Belongs to the NK-2 homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • NKX2.5, mouse, homolog of antibody
    • Cardiac-specific homeobox 1 antibody
    • Cardiac-specific homeobox antibody
    • CHNG5 antibody
    • CSX antibody
    • CSX1 antibody
    • FLJ52202 antibody
    • FLJ97166 antibody
    • FLJ97195 antibody
    • FLJ97197 antibody
    • FLJ99536 antibody
    • HLHS2 antibody
    • Homeobox protein CSX antibody
    • Homeobox protein NK-2 homolog E antibody
    • Homeobox protein Nkx 2.5 antibody
    • Homeobox protein Nkx-2.5 antibody
    • NK2 homeobox 5 antibody
    • NK2 transcription factor related locus 5 antibody
    • NK2 transcription factor related, locus 5 (Drosophila) antibody
    • NK2, Drosophila, homolog of, E antibody
    • NKX2-5 antibody
    • NKX2.5 antibody
    • NKX25_HUMAN antibody
    • Nkx2E antibody
    • NKX4-1 antibody
    • Tinman paralog antibody
    • VSD3 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat heart tissue, labeling Nkx2.5 using ab214296 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Dergilev K  et al. C-Kit Cardiac Progenitor Cell Based Cell Sheet Improves Vascularization and Attenuates Cardiac Remodeling following Myocardial Infarction in Rats. Biomed Res Int 2018:3536854 (2018). Read more (PubMed: 30046593) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up