Overview

  • Product name

  • Description

    Rabbit polyclonal to NLE1/nle
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NLE1/nle aa 206-485.
    Sequence:

    SWEPLHANPECRYVASSSKDGSVRIWDTTAGRCERILTGHTQSVTCLRWG GDGLLYSASQDRTIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGA FEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDDFTLFL WSPAEDKKPLTRMTGHQALINQVLFSPDSRIVASASFDKSIKLWDGRTGK YLASLRGHVAAVYQIAWSADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGH ADEVYAVDWSPDGQRVASGGKDKCLRIWRR


    Database link: Q9NVX2

  • Positive control

    • WB: PC-3 whole cell lysate. IHC-P: Human gastric cancer and small intestine tissues.
  • General notes

     This product was previously labelled as NLE1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230212 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 53 kDa (predicted molecular weight: 53 kDa).

Target

Images

  • Anti-NLE1/nle antibody (ab230212) at 1/1000 dilution + PC-3 (human prostate adenocarcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 53 kDa
    Observed band size: 53 kDa

  • Paraffin-embedded human small intestine tissue stained for NLE1/nle using ab230212 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for NLE1/nle using ab230212 at 1/100 dilution in immunohistochemical analysis.

References

ab230212 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230212.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up