Overview

  • Product name

  • Description

    Rabbit polyclonal to NLN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Pig, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NLN aa 109-241.
    Sequence:

    PQHVSSDKEVRAASTEADKRLSRFDIEMSMRGDIFERIVHLQETCDLGKI KPEARRYLEKSIKMGKRNGLHLPEQVQNEIKSMKKRMSELCIDFNKNLNE DDTFLVFSKAELGALPDDFIDSLEKTDDDKYKI


    Database link: Q9BYT8

  • Positive control

    • WB: HEK-293, PC-3, HepG2, L02 and A549 whole cell lysates. IHC-P: Human pancreatic cancer tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 81 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-NLN antibody (ab237756) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : L02 (human immortal liver cell line) whole cell lysate
    Lane 5 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 81 kDa

  • Paraffin-embedded human pancreatic cancer tissue stained for NLN using ab237756 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for NLN using ab237756 at a dilution of 1/100 in ICC/IF.
    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.

References

ab237756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up