Overview

  • Product name

    Anti-NLN antibody [OTI1D6]
    See all NLN primary antibodies
  • Description

    Mouse monoclonal [OTI1D6] to NLN
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, Monkey
  • Immunogen

    Recombinant full length protein corresponding to Human NLN aa 1-704. Produced in HEK293T cells (NP_065777).
    Sequence:

    MIARCLLAVRSLRRVGGSRILLRMTLGREVMSPLQAMSSYTVAGRNVLRW DLSPEQIKTRTEELIVQTKQVYDAVGMLGIEEVTYENCLQALADVEVKYI VERTMLDFPQHVSSDKEVRAASTEADKRLSRFDIEMSMRGDIFERIVHLQ ETCDLGKIKPEARRYLEKSIKMGKRNGLHLPEQVQNEIKSMKKRMSELCI DFNKNLNEDDTFLVFSKAELGALPDDFIDSLEKTDDDKYKITLKYPHYFP VMKKCCIPETRRRMEMAFNTRCKEENTIILQQLLPLRTKVAKLLGYSTHA DFVLEMNTAKSTSRVTAFLDDLSQKLKPLGEAEREFILNLKKKECKDRGF EYDGKINAWDLYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNTYQEL LGLSFEQMTDAHVWNKSVTLYTVKDKATGEVLGQFYLDLYPREGKYNHAA CFGLQPGCLLPDGSRMMAVAALVVNFSQPVAGRPSLLRHDEVRTYFHEFG HVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDVDSLRRLSKHYK DGSPIADDLLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTNTSLDAASEY AKYCSEILGVAATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSC FKKEGIMNPEVGMKYRNLILKPGGSLDGMDMLHNFLKREPNQKAFLMSRG LHAP


    Database link: Q9BYT8

  • Positive control

    • WB: HEK-293T cells transfected with NLN, HepG2, HeLa, SVT2, A549, COS7, PC12, and MCF7 cell extracts. IHC-P: Carcinoma of Human pancreas, Adenocarcinoma of Human endometrium, Carcinoma of Human bladder and Human tonsil tissues. ICC/IF: COS7 cells transiently transfected with NLN. Flow: Jurkat cells.
  • General notes

    The clone number has been updated from 1D6 to OTI1D6, both clone numbers name the same clone.

Properties

Applications

Our Abpromise guarantee covers the use of ab119802 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 81 kDa.
IHC-P 1/150.
ICC/IF 1/100.
Flow Cyt 1/100.

Target

Images

  • All lanes : Anti-NLN antibody [OTI1D6] (ab119802) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK293T cell lysate transfected with pCMV6-ENTRY NLN cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 81 kDa

  • All lanes : Anti-NLN antibody [OTI1D6] (ab119802) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : SVT2 cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell extract
    Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) cell lysate
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 7 : MDCK cell extract
    Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line)
    cell lysate
    Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell lysate

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 81 kDa

  • Paraffin-embedded human pancreas carcinoma tissue stained for NLN using ab119802 at 1/150 dilution in immunohistochemical analysis.

     

  • Paraffin-embedded human endometrium adenocarcinoma tissue stained for NLN using ab119802 at 1/150 dilution in immunohistochemical analysis.

     

  • Paraffin-embedded human bladder carcinoma tissue stained for NLN using ab119802 at 1/150 dilution in immunohistochemical analysis.

     

  • Paraffin-embedded human tonsil tissue stained for NLN using ab119802 at 1/150 dilution in immunohistochemical analysis.

     

  • COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY NLN, stained for NLN (green) using ab119802 at 1/100 dilution in ICC/IF.

     

  • Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cells using ab119802 at 1/100 dilution stained for NLN (Red) compared to a nonspecific negetive control antibody (Blue).

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab119802.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up