Overview

  • Product name

  • Description

    Rabbit polyclonal to NLRC3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NLRC3 aa 58-146.
    Sequence:

    SNDSRIQRHRKALLSKVGGGPELGGPWHRLASLLLVEGLTDLQLREHDFT QVEATRGGGHPARTVALDRLFLPLSRVSVPPRVSITIGV


    Database link: Q7RTR2

  • Positive control

    • ICC/IF: NB-4 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May modulate T-cell activation. Decreases the transcription of genes that are normally up-regulated after T-cell stimulation. Delays degradation of NFKBIA/IKBA.
  • Tissue specificity

    Detected in peripheral blood mononuclear cells.
  • Sequence similarities

    Belongs to the NLRP family.
    Contains 16 LRR (leucine-rich) repeats.
    Contains 1 NACHT domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CARD15-like antibody
    • CARD15-like protein antibody
    • Caterpiller 16.2 antibody
    • Caterpiller protein 16.2 antibody
    • CLR16.2 antibody
    • FLJ00348 antibody
    • NLR family CARD domain containing 3 antibody
    • Nlrc3 antibody
    • NLRC3_HUMAN antibody
    • NOD-like receptor C3 antibody
    • NOD3 antibody
    • NOD3 protein antibody
    • Nucleotide-binding oligomerization domain protein 3 antibody
    • Nucleotide-binding oligomerization domain protein 3 caterpiller 16.2 antibody
    • nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 3 antibody
    • Protein NLRC3 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized NB-4 cells stained for NLRC3 (green) using ab222200 at 4 µg/ml in ICC/IF.

References

ab222200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up